KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7118Help
Entry
OCAR_7118         CDS       T00783                                 

Definition
protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OCAR_7118
Enzymes [BR:oca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     OCAR_7118
Transfer RNA biogenesis [BR:oca03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    OCAR_7118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3083324..3084157
Genome map
AA seq 277 aa AA seqDB search
MALMEPLTKLAVEAGAAILSINRATMGLAQKPDGSSVTDADMAADAIIAQGLARLAPGIP
VLSEERTHAAARPYRDSFFLIDPLDGTHEFIDGRDEFTVNIALVTQGAPLLGIIVAPALG
TVWRGIVGRGAERLLTTKDGASWGAPQPIRTRPHPGPAIPWIAAVSRSHADPRTEAFILA
RPGAVRQVLGSSIKFCRVAEGGADIYPRLAPTSEWDIGAGHAVLTAAGGLVTGEDGKPLV
FGEEHDGFGIPSFIAWGDPAAARNGAAAPQPQKQQPQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttgatggagccgctgacaaagctcgccgtcgaggcgggcgccgcgatcctgtcg
atcaaccgcgccaccatggggctcgctcaaaaacccgacggctcttcggtgaccgatgct
gacatggcggcggacgcgatcatcgcgcagggcctcgcccgtcttgcgcccggcattccg
gtgctgtcggaagaacgcacgcacgccgccgcccggccctaccgcgacagcttcttcctg
attgatccgctcgatggcacccacgagttcatcgacgggcgcgacgaattcacggtcaac
attgccctcgtcacgcaaggtgcccccctgctcggcatcatcgtcgcgccggcgctcggg
accgtatggcgcggcatcgtcggccgaggcgccgaacggctgctcaccaccaaggacggc
gcaagctggggcgcgccccagccgatccggacccggccgcaccccggccccgccataccg
tggatcgccgccgtcagccgctcccatgccgatccccgcacggaagccttcatcctggcc
cggcccggcgcagtccggcaggtgctcggctcctccatcaagttctgccgtgtcgccgaa
ggtggcgccgatatctatccacgcctcgcgccgaccagcgaatgggacatcggggcgggc
catgccgttctcacggcggcgggcggcctcgtcaccggggaggacggcaagccgctcgtc
ttcggcgaggagcacgatggcttcggcatcccgagcttcatcgcctggggcgacccggct
gccgcaaggaatggcgcggccgcgccgcagccccaaaagcagcaacctcaataa

DBGET integrated database retrieval system