KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7381Help
Entry
OCAR_7381         CDS       T00783                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:oca00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:oca00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3339494..3340282)
Genome map
AA seq 262 aa AA seqDB search
MSSLAGKAAVVTGSTSGIGLAYARALARAGANIVLNGMGEPADIEKERSGIEREFGVKAV
HSPADMTRPDEIEQMVRLGEKTLGSVDILINNAGIQFVSPVEEFPLDKWDAIIAINLSSA
FHAIRAAVPGMKARGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNAISPGYVWTPLVERQVPDTMKARNMTKEEVIKDVMLLAQPTKEFVTVEQVAALAVYL
CGDEASQITGANLSIDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagttcattggcaggcaaggccgcggtcgtcaccggatcgaccagcggcatcggattg
gcatatgcgcgggcgctcgcgcgggccggcgcgaatatcgtgctgaacggcatgggcgag
cccgccgatatcgagaaggagcggtcggggatcgagcgcgagttcggcgtcaaggcggtt
cattcgcccgccgatatgaccaggcccgatgagatcgaacagatggttcggctcggcgaa
aagacgctcggttcggtcgatattctcatcaacaatgcgggcatccagttcgtctcgccg
gtcgaggaatttccgctcgacaaatgggacgcgatcatcgccatcaatttgtcatcggcg
tttcatgcaatccgcgccgcggtgccaggcatgaaggcgcgcggttggggccgcatcatc
aacaccgcatcggcgcactcgctggtggcctcgccgttcaagtcggcttacgtcgcggcg
aagcacggcattgccggtctcaccaagacggtcgcgctcgaacttgcgacccacaagatc
acctgcaacgccatcagccccggttatgtctggacgccgcttgtcgagcggcaggtgccc
gacaccatgaaggcgcgcaacatgaccaaggaagaggtcatcaaggacgtgatgctgctg
gcgcagccgaccaaggagttcgtcaccgtcgagcaggtcgcggcgcttgcggtctatctc
tgcggcgacgaggcgagccagatcaccggcgccaatctctcgatcgacggcggctggacc
gcggcttaa

DBGET integrated database retrieval system