KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7536Help
Entry
OCAR_7536         CDS       T00783                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00300  Lysine biosynthesis
oca01100  Metabolic pathways
oca01120  Microbial metabolism in diverse environments
oca01230  Biosynthesis of amino acids
Module
oca_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCAR_7536 (dapE)
Enzymes [BR:oca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OCAR_7536 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACI94638
UniProt: B6JJP4
Position
3492650..3493804
Genome map
AA seq 384 aa AA seqDB search
MSKALDIARDLLACPSVTPADAGALGVLEKLLKDAGFETYRLTFSEPGADDTDNLYARIG
AGHPHITFAGHTDVVPPGDNAAWSHDAFAATVDGGVLYGRGAVDMKGAIACAAAAVLDYL
EANGGKPKGSISFLITGDEEGPAVNGTVKLLDWAAKRGEKFDHCLLGEPSNVNALGDCIK
AGRRGSLSGTLIVEGKQGHAAYPDRAHNPLPEIASLVAALDADPLDQGSDHFPPSNLEFL
SIDTGNPAWNVIPAQARARFNIRHNDCRTQDALRALIEARVEKLTGNRITARIEWEPSNA
DAFLTQPGAFTDLVIDAIEEVTGRKPKLDTGGGTSDARFITHYCPVLEFGLVGQTMHQID
ERTPVADLDALTQIYRGVLTRYFK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgctcgacattgcccgtgatcttctggcttgcccctcggtgacgccggcg
gatgcgggtgcgctcggcgtgctcgaaaagcttttgaaggatgccggtttcgaaacctat
cgcctgacgttcagcgagccgggcgcggacgacaccgacaacctctatgcgcgcatcggg
gccggccatccgcacatcaccttcgcgggtcacaccgacgtggtgccacccggcgataat
gcagcgtggtcgcacgatgcattcgcggccacagtcgacggcggcgtgctctatggccgc
ggtgccgtcgacatgaagggcgcgatcgcctgcgccgccgccgccgtgctcgattatctc
gaagccaacggtggtaaaccaaagggctcgatctcgttcctcatcaccggcgacgaggaa
ggccccgccgtcaacggcacggtgaagctgctcgactgggccgcgaagcgcggcgaaaaa
ttcgaccactgcctgctcggcgaacccagcaacgtcaacgcgctcggcgactgcatcaag
gcagggcggcgcggctcgctgtccggcacgctgatcgtcgaaggcaagcagggccacgcg
gcctatcccgaccgtgcgcataatccattgcctgaaatcgcaagcctcgtcgcagcgctt
gatgccgatccgctcgatcagggcagcgatcactttccgccgtccaacctcgaatttctg
tcgatcgacaccggcaatccggcgtggaacgtgatcccggcgcaggcgcgcgcgcgcttc
aacatccgccacaacgattgccgcacgcaggacgcgctacgtgccttgatcgaagcgcgt
gtcgagaaactcacaggcaaccgcatcaccgcgcgcatcgagtgggagccgtcgaacgcc
gacgcttttctgacgcagccgggcgcgttcactgatctcgttatcgacgcgatcgaggaa
gtgaccggacgcaagccgaagctcgacaccggcggcggcacctcggatgcacgcttcatc
acccattactgtccggtgctggaattcggcctcgtcggccaaaccatgcaccagatcgac
gagcgcacgccggtcgccgatctcgacgcgctgacgcaaatctatcgcggcgttcttacg
cgctacttcaagtga

DBGET integrated database retrieval system