KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7543Help
Entry
OCAR_7543         CDS       T00783                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCAR_7543 (recR)
DNA repair and recombination proteins [BR:oca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OCAR_7543 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3499849..3500454)
Genome map
AA seq 201 aa AA seqDB search
MASTVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKREALMAPLASALQVAIERIQVC
HTCGNIDTQNPCTICSDPRRDPAIIVVVADVSDLWALERAHATQGRYHVLGATLSPLDGI
GPQDLTIDALVTRAQVPEVTEIILALNATVDGQTTAHYVTDMLQDANVKVTRLAHGVPVG
GELDYLDEGTLSAAMRQRTLF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaccgttgccggaccggagatcgagcggctgatccagttgctggcgcggctt
ccgggccttggcccgcgctcggcccgccgcgcggcgctgcatctcatcaagaagcgcgaa
gctctgatggcgccgctcgcctccgcattgcaagttgcgatcgagcgcattcaggtgtgc
cacacctgcggcaacatcgacacgcagaacccgtgcacgatctgcagcgacccgcggcgt
gatccggcgatcattgtggtggtggccgacgtctccgacctctgggcgctggagcgtgcg
catgcaacgcagggtcgctatcatgtgttgggtgcgacgctgtcgccgctcgacggcatc
ggcccgcaagacctcaccatcgatgcgctggtgacgcgcgcgcaggtgcccgaagtgacc
gagatcattctcgcgctcaatgccactgtcgatggccagaccacggcgcactacgtcacc
gacatgctgcaggatgccaacgtcaaggtgacgcggctcgcgcatggcgtgccggtcggc
ggcgaactcgattatctcgatgagggtacgctgtcggcggcgatgcggcagcggacgctg
ttctag

DBGET integrated database retrieval system