KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7560Help
Entry
OCAR_7560         CDS       T00783                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCAR_7560
   00030 Pentose phosphate pathway
    OCAR_7560
   00051 Fructose and mannose metabolism
    OCAR_7560
   00052 Galactose metabolism
    OCAR_7560
   00500 Starch and sucrose metabolism
    OCAR_7560
   00520 Amino sugar and nucleotide sugar metabolism
    OCAR_7560
  Nucleotide metabolism
   00230 Purine metabolism
    OCAR_7560
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCAR_7560
Enzymes [BR:oca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     OCAR_7560
    5.4.2.8  phosphomannomutase
     OCAR_7560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3515657..3517156)
Genome map
AA seq 499 aa AA seqDB search
MFPKPKAELKPNTYAYESEPMVKATGFREYDARWLFGKEINLMGVQALGMGLGTMIGEMS
VKQEIVVGHDFRGYSASIKYALISGLLAAGCKVHDIGLAVTPMAYFAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLGAAFKLQPAGGYQFHENFPARYIADL
TKRKPFSRRIRAVVACGNGTAGAFAPQVLEKLGVDVIPLDTELDHTFPKYNPNPEDLEML
HAIRDAVLEHKADVGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSALHKNAQFVVD
VKSTGLFVTDPVLSRQGAQASYWKTGHSYMKRRTHELGALAGFEKSGHFFFNAPFGRGYD
DGLVSAIAICEMLDHAPGKKMSDLKNALPKTWSSPTMSPHCADEAKYGIVDKVVKHFETA
KAKGDKVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEKRMREMFE
AMDSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgaagccgaaagccgagctgaagcccaatacctacgcctatgaatccgagccg
atggtgaaggccaccggcttccgcgaatacgatgcgcgatggctgttcggcaaggaaatc
aacctgatgggcgttcaggcgctcggcatgggcctcggcaccatgatcggcgagatgagt
gtgaagcaggagatcgtggtcggccacgacttccgtggctactcggcctcgatcaaatac
gcgctgatctcgggcctgctcgcggccggctgcaaggtgcacgacatcggccttgcggtg
acgccgatggcctatttcgcgcagttcgatctcgacgtgccttgcgtggcgatggtcacg
gcctcgcataacgacaatggctggaccggcgtgaagatgggcgcgaaccggccgctcacc
ttcggtcccgacgagatgacgcggctgaaggagattgtgttgggcgcggccttcaagctg
cagccggccggtggctatcagtttcacgagaatttcccggcgcgctacatcgcggacctc
accaagcgcaagccgttctcgcgccgcatccgcgcggtggtcgcctgcggcaatggcacg
gcgggcgcattcgcaccgcaggtgctggaaaagctcggcgtcgacgttatcccgctcgat
accgaactcgaccacaccttcccgaaatacaatccgaatcctgaagaccttgagatgctg
catgcaatccgcgacgcggtgctcgaacacaaggccgatgtcggcctcggcttcgacggc
gatggcgatcgctgtggcgtggtcgacgacaccggtgaggaaatcttcgccgacaaggtc
ggcgtgatgctggcgcgcgatatgtcggcattgcacaagaacgcgcagttcgtcgtcgac
gtgaagtcgaccggattgttcgtcaccgatccggtgctctcgaggcagggcgctcaggcg
agttactggaagaccggccactcctacatgaagcgccgcacgcatgagcttggcgcgctg
gcgggcttcgagaagtccggccacttcttcttcaatgcgccgttcgggcgtggctatgac
gacggtctcgtctccgcgatcgcgatctgcgagatgctcgaccacgcgcccggcaagaag
atgtcggacctgaagaacgcgttgccgaaaacctggtcgtcgccgacgatgtcgccgcac
tgcgcggacgaagcgaagtacggcatcgtcgacaaggtggtgaagcatttcgagacggcg
aaggcgaagggcgacaaggtcgccggtcagccgatccgcgatctcgtcacagtgaacggc
gtgcgcgtcacctgcgaggacggaagctggggccttgtgcgcgcatcatcgaacaagccc
gaacttgtcgtggtggtggaaagcccggtctccgagaagcgcatgcgcgagatgttcgag
gcgatggacagcgttctgcgcacccatcccgaagtcggcgaatacaatcagaagatttaa

DBGET integrated database retrieval system