KEGG   Oceanimonas sp. GK1: GU3_00775Help
Entry
GU3_00775         CDS       T01667                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
oce  Oceanimonas sp. GK1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GU3_00775
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GU3_00775
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GU3_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164248..165261)
Genome map
AA seq 337 aa AA seqDB search
MTKQVLGGFPGRRLRRLRKHDFSRRLVREHTLTVDDLIYPMFVLPGIQRREAVASMPGIE
RLSIDLLLEEAAELVALGIPLIALFPVVNPSEKSLLAEEAYNPDGLVQEAVRELKAAFPA
LGIMTDVALDPYTVHGQDGILDKDGYVLNDVTTEVLVKQALSHAAAGADMVAPSDMMDGR
IGAIRQALEENGFINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGNKATYQMDPANTDE
ALQEVAFDLEEGADMVMVKPGMPYLDVVRRVKDQFGVPTFAYQVSGEYAMHMAAIQNGWL
KERETIMESLLCFKRAGADGILTYFSKRVAQWLKEQD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaagttctgggaggctttcccggccgccgtctgcgccgtttgcgcaagcac
gatttcagccgtcgtctggtgcgcgagcacaccctgaccgtggacgatctgatctacccg
atgttcgtgctgccgggcattcagcgtcgtgaagcggtggcctccatgcccggtattgag
cggctgtccatcgatctgctgctggaggaagccgccgagctggtggctctgggaattccg
ctgatcgccctgttcccggtagtgaatccgtccgaaaagtccttgctggcggaagaagcg
tacaaccccgacggcctggtgcaggaagcggtgcgtgagctgaaggccgcctttccggcg
ctcggcatcatgaccgacgtggcgctggacccgtacaccgtacacggccaggatggcatt
ctcgataaagacggctacgtactcaatgacgtcaccaccgaggtgctggtgaagcaggcg
ctcagccacgccgccgccggtgccgatatggtggccccgtccgacatgatggacggccgc
atcggcgccattcgccaggcgctggaagagaacggctttatcaacacccagatcatggcc
tactccgccaagtacgcgtccaactactatggcccctttcgcgatgcggtcggctctgcc
ggcaacctcaaggggggcaacaaggcgacctatcagatggatcccgccaataccgacgag
gcgctgcaggaagtcgccttcgatctggaggagggggccgacatggtgatggtcaagccg
ggcatgccctatctggatgtggtgcgtcgggtcaaggatcagttcggggtaccgaccttt
gcctatcaggtgagtggcgaatacgccatgcacatggcggccattcagaacggctggctc
aaggaaagggaaaccatcatggagtcgctgctgtgcttcaagcgcgccggcgccgacggc
attctcacctacttttccaagcgggtggcgcagtggctgaaggagcaggactga

DBGET integrated database retrieval system