KEGG   Oceanimonas sp. GK1: GU3_01175Help
Entry
GU3_01175         CDS       T01667                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
oce  Oceanimonas sp. GK1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:oce00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236883..238406
Genome map
AA seq 507 aa AA seqDB search
MPDNSVPAVHSLLATAMGIDTHQEPVVFLRADSEVCRAEGFIANTRIQVTVGEHSLIATL
NVVTNEVLPARHIGFSRIAWERLALLGDEEVSVRHAPVLHSMSAVRKKMYGNTLSKREMN
DIIADISQHRYSDMQIAAFLTACVERLDTDEVIALTQSMVDSGKRLSWPTRLQLVDKHCI
GGLPGNRTTPIVVAIASAAGLIMAKTSSRAITSPAGTADTMEVLTRVHLDLAEIQATVRK
VNACLVWGGAVNLSPADDMLIRIERALDIDGTGQMVASVLSKKIAAGSTHVLIDIPVGPT
AKVRSQPDAEAMSRLFETVGQALRLKVRCLITDGSEAIGYGLGPAQEARDVLAVLQNQPE
APADLRERALLLAAHLLNMAGKGELDDTSRQARELLESGQAWHQFRRICEAQGGLKPIPE
AACSLQQGARHSGTLLAMDNRRLSRLAKLAGAPNSPAAGLRLHAKLGQALAMGQPLFTLY
ADSQGELDYAADYYEHNHDLFMIGEAP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgccggacaacagcgtgcctgccgttcactccctgcttgccactgccatgggcatcgac
actcaccaggaaccggtggtgtttctgcgtgccgacagtgaagtgtgccgcgccgagggg
tttattgccaacacccgtattcaggttaccgtcggcgagcacagtctgatcgccaccctc
aacgtggtcaccaacgaggtactgccggcccggcatatcggattttcccgcatcgcctgg
gagcgcctggccctgctcggcgatgaggaagtttccgtacgccacgccccggtgctgcac
tccatgagcgcagtgcgcaaaaagatgtacggcaacaccctgtcgaaacgggaaatgaac
gacatcattgccgacatcagccagcaccgctattccgacatgcagatcgccgcctttctg
accgcctgtgtcgaacggctcgataccgatgaggtcatcgccctgacccagtccatggtg
gacagcggcaaacgcctgagctggccgacgcggctacaactggtcgacaaacactgcatt
ggcggcctgcccggcaaccgcaccacccccatagtggtggccattgccagcgccgccggt
cttatcatggccaagacctcgtcccgagccattacctcccctgccggcaccgccgatacc
atggaagtgctcacccgggtacacctggacctggcagaaatccaggccacggtgcgcaag
gtcaatgcctgcctggtgtggggcggtgccgtcaatctgagcccggcggacgacatgctc
attcgcattgagcgggcgctggatatcgacggcaccggccagatggtggcctcggtgctg
tcgaaaaaaatcgccgccggctccacccacgtcctgatcgatattccggtgggccccacc
gccaaggtgcgcagccaacccgacgccgaggccatgagccggctgtttgaaaccgtgggt
caggccctgcggctgaaggtacgctgtctgatcaccgacggcagcgaggccatcggctac
ggccttggtcccgcccaggaggccagagatgtgctggcggtgctgcagaaccagcccgag
gcccccgccgatctgcgcgagcgagccctgctgctggccgcccacctgctcaatatggcg
ggcaagggtgagctggatgatacctcccggcaagcccgggagttgctggaatcgggccag
gcctggcaccagttccggcgcatttgcgaggcccagggcggactcaagcccatacccgag
gcggcctgttccctgcagcagggcgcccgccacagcggcaccctgctggccatggacaac
cgccgcctgtcccggctggccaaactggccggcgcccccaatagccctgccgccggactt
cggctgcacgccaagctgggccaggcgctggccatggggcagccgctgtttaccctctat
gccgacagccagggcgagctggactacgccgccgactactatgagcacaatcacgacctg
ttcatgattggagaggcaccatga

DBGET integrated database retrieval system