KEGG   Oceanimonas sp. GK1: GU3_02230Help
Entry
GU3_02230         CDS       T01667                                 

Definition
F0F1 ATP synthase subunit C
Orthology
K02110  
F-type H+-transporting ATPase subunit c
Organism
oce  Oceanimonas sp. GK1
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    GU3_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464407..464631
Genome map
AA seq 74 aa AA seqDB search
MEMIFIAASLMLGLASIGGAIGISMLGGKFLESAARQPDMLPALRGNFFIVVGLVDAIPM
ITVGMALYLIFAVA
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgattttcatcgctgcctctctcatgctgggtctggcttctatcggtggtgct
atcggtatctctatgctgggtggcaagttcctggaaagtgctgctcgccagcctgacatg
ctgcctgccctgcgcggcaacttcttcatcgtggtaggtctggttgacgccatcccgatg
atcaccgttggtatggctctgtacctgatcttcgccgtagcctaa

DBGET integrated database retrieval system