KEGG   Oceanimonas sp. GK1: GU3_02405Help
Entry
GU3_02405         CDS       T01667                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
oce  Oceanimonas sp. GK1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GU3_02405
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GU3_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(510708..511463)
Genome map
AA seq 251 aa AA seqDB search
MIPLVVRPEPQNHRLCEALRQAGHQPVATPLLSFAPGAELAQAPRLLGELGSRDYVIAVS
VAAVNFADNALKTRGQPWPDVTYVAVGEATGRALAAVGVPHALVPDDPRSEGMAALPELQ
NPAGCRVLILRGDGGRDMMAPTLTQRGAQVAYCEVYRRCYRDDAGEQLVKEWQRQGVDSI
IITSGGLLQHLFQLAADSAKDWLLSRLLIVPSIRVTEQAKALGFTHIINAKGASNPALLS
ALDERKRNDRQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccgctggtggtgcgtcccgagccgcaaaaccaccgcctgtgcgaggccctgcgc
caggccggccaccagccggtggccacgcccctgctgagctttgcccccggcgccgagctg
gcgcaggcgccccgtctgctgggggagctcggcagccgggattatgtgattgcggtcagc
gtagcggcggtgaatttcgccgataatgccctcaaaacgcgcggacagccctggcccgac
gtcacctatgtggcggtgggtgaagccaccggccgggcgttggccgccgtgggcgtgccc
catgcactggtgccggacgacccccgctccgagggcatggcggccctgcccgagctgcag
aacccggccggatgccgcgtcttgatcctgcgcggcgacggcggccgggacatgatggcc
cccaccctgacacagcggggggctcaggtggcctactgcgaagtctaccggcgctgctat
cgtgatgatgccggtgaacaactggtgaaagagtggcaacgccagggggtggacagtatt
atcatcaccagtggcggcctgctgcagcacctgtttcagcttgcggccgacagcgcaaag
gactggctgctaagccgtttattgattgtgcccagcattcgcgtgaccgaacaggcgaag
gccttgggcttcactcatatcatcaatgccaaaggtgcatccaacccggcgttgctcagc
gccctggatgagaggaaaaggaatgacagacaataa

DBGET integrated database retrieval system