KEGG   Oceanimonas sp. GK1: GU3_03075Help
Entry
GU3_03075         CDS       T01667                                 

Definition
(GenBank) Lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GU3_03075
Enzymes [BR:oce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GU3_03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LCAT Ser_hydrolase PGAP1 DUF900 LIDHydrolase
Motif
Other DBs
NCBI-ProteinID: AEY00372
UniProt: H2FZK2
Position
complement(660914..661954)
Genome map
AA seq 346 aa AA seqDB search
MLARLFLLGICLAMNTAVAQTPRLTTETELAELGLGGLQQYWQAHAIEGHFTGQNDLALP
WAALRNPEHGSTLVIVNGRTESYLKYQELARDLFENGYNVYLYDHRGQGLAPRLGADPLM
GHVADFNDYVQDLEQFMQQVVLPAGPQPVYLLAHSMGGTISALWLSQTQVRIQAAALSSP
MMGIYLGPMPRWLADGLVAVLGTGCRWLGHDACYAPGQGGYEETPFADNELTHSELRYRL
FRELYRVRPELQLGGVSLHWLGESLAAGDRTIARARLITTPLLVLQASRDVVVDNEAQNA
FCQTLSHCEGGGPKRIKGASHELFIEQDKYRRQALNAVFDFFEKHP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcctgttcctgctcgggatctgccttgccatgaacaccgccgtcgcccaa
accccgcgcctgaccaccgaaaccgagctggccgagctgggcctcggcggcctgcagcaa
tactggcaggcccacgccattgaaggccactttaccggccagaatgatctggccctgccc
tgggccgccctgcgcaaccccgaacacggcagtaccctggtgatcgtcaacggccgcacc
gagtcctacctcaagtaccaggagctggcgcgggatctgtttgaaaacggctacaacgtc
tatctctatgatcaccggggccagggcctggccccccggctcggcgccgatccgctgatg
ggccatgtggcggactttaacgactatgtgcaggatctggagcagttcatgcagcaggtg
gtgctgcctgccggcccgcaaccggtctacctgctggcccattccatgggtggcaccatc
tcggcgctgtggctgagccagacgcaagtgcgcatacaggcagcggccctgtcttcaccc
atgatgggcatctacctcggccccatgccgcgctggctggccgacggcctggtcgccgta
ctgggcaccggctgccgctggctgggtcatgacgcctgctacgcgcccggccagggtggc
tacgaggaaaccccctttgccgacaacgagctcacccacagcgagctgcgctaccggctg
ttccgtgagctgtaccgcgtccgccccgagctgcagctgggcggggtcagcctgcactgg
ctgggagaaagcctggccgccggcgaccgcaccattgcccgggcccggctgattaccacc
ccgctgctggtattgcaggccagccgggacgtggtggtggacaacgaggcgcaaaatgcc
ttttgccagaccttgagccactgcgagggaggcgggcccaagcgcatcaagggcgcctcc
cacgagctgtttatcgaacaggacaagtaccgtcggcaggcgctgaacgccgtattcgac
ttttttgaaaaacacccctga

DBGET integrated database retrieval system