KEGG   Oceanimonas sp. GK1: GU3_03805Help
Entry
GU3_03805         CDS       T01667                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00790  Folate biosynthesis
oce01100  Metabolic pathways
Module
oce_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GU3_03805
Enzymes [BR:oce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GU3_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AEY00518
UniProt: H2FZS1
Position
complement(815392..815880)
Genome map
AA seq 162 aa AA seqDB search
MTTVFVALGANLNEPLARIRAARQALQALATPGSLRHARLYRSRPMGPADQPDYLNSVSV
FDTELAPHALLDALQAIEQREGRVRKDERWGPRALDLDLLLYGEQRIDDERLTVPHYGMK
QREFVLYPLADLAPGLVLPCGTSLSSLLQQCPLNGMLPLPEQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtttttgtggccctgggcgccaacctgaatgagcccctggcgcgcattcgg
gccgctcggcaggccttgcaggccctggccacccccggcagcctgcgccatgcccggctg
taccgcagcaggcccatgggccccgcagatcagccggactatctcaacagcgtctcggtg
tttgacaccgagctggcgccccacgccctgctcgatgccctccaggccatcgaacaacgg
gaaggccgggtgcgcaaggacgaacgctggggcccccgggcgctcgatctcgacctgctg
ctctatggcgagcagcgcatcgacgacgagcgtctgaccgtgccccactacggcatgaag
caaagggaattcgtactctacccactggcggatctggccccgggcctggttcttccctgc
ggtacctccctctcctccctgctgcaacagtgcccgcttaacggcatgctcccgctgccc
gagcagtaa

DBGET integrated database retrieval system