KEGG   Oceanimonas sp. GK1: GU3_04345Help
Entry
GU3_04345         CDS       T01667                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
oce  Oceanimonas sp. GK1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:oce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:oce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941529..943013
Genome map
AA seq 494 aa AA seqDB search
MSLTLRELAIPLGHAAPAIAIEHITLDSRAVTPGCLFIAVKGHQTDGRQFIGSALERGAS
AVIYQADTPEAAGLDAQDHRLLGVYRLPEQLSRLAGAFYGDPSRQLQLVGVTGTNGKSTV
SQLIAHWSQLLGTTTGVMGTLGNGLCGRLRPAVNTTGSALEVQAELAAMLDAGARRVAME
VSSHGLHQHRVAALDFDVAVFTNLSRDHLDYHGTMAEYGEVKRGLFELCRQGRVINADDV
HGRRWLAHYPDAVAYSLHGRMADFPGRQLVAETVHFYGDGVKVTINSDWGNGVLSAPLIG
RFNVANLLAAMGALLVLGESFERLLETAPKLVGVAGRMEPFTAPGKPLVVVDYAHTPDAL
EQVLQALRLHCRGRLWCLVGCGGDRDRGKRPLMAAAGENGADELILTDDNPRTESPAAII
SDMQAGLSAPNTARVIHSRAEAIAYAVGAANEQDIILVAGKGHEDYQIVGTQTLHYSDRE
TVAAALAAALGADR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtccctcacacttagagagctggcgattcccctgggccacgcggccccggccatcgcc
attgagcacatcaccctcgacagccgggcggtcacccccggctgcctgtttattgccgtt
aaaggccatcagaccgacggtcgtcagtttatcggcagtgccctggagcggggtgcttcg
gcggtgatctatcaggccgacacccccgaagcggccggcctggatgcccaggaccaccgc
ctgctgggcgtgtaccggctgccggagcagctgtcgcggctggccggtgccttttatggc
gacccgtcgcggcaactgcaactggtgggggtgaccggtaccaacggcaaaagcaccgtc
tcccagctgatcgcccactggagccagttgctgggcaccaccaccggcgtgatgggtacc
ctgggcaacggcttgtgcggccggcttcggcctgccgtcaacaccaccggctcggcgctg
gaggtgcaggccgagctggcggccatgctcgacgccggtgcgcgcagagtggcgatggag
gtgtcttcccacggcctgcatcagcaccgagtggccgcgctggattttgacgtagcggtg
ttcaccaacctgagccgggatcatctggattaccacggcaccatggcggaatacggtgag
gtcaagcgcggcctgttcgaactgtgccgccagggccgggtgatcaacgccgatgacgtt
cacggccggcgctggctggctcattaccccgacgccgtggcctacagcctgcacggccga
atggcggattttcccggccgccagctggtggcggaaacggtgcatttttatggtgacggg
gtgaaagtgaccattaactccgactgggggaatggtgtattatccgcccccctgatcggc
cgtttcaatgtcgccaatctgctggcggccatgggggcgttattggtgcttggtgagtcc
ttcgagcgactgctggaaaccgcccccaaactggtgggggtggccgggcgcatggagccc
tttaccgcccccggcaagccgctggtggtggtggactatgcccacaccccggatgccctg
gagcaggtgctacaggcgctgcgtctgcactgccggggccggctgtggtgcctggtgggc
tgcggcggcgatcgggacaggggcaagcggccgctgatggcggcggcgggggaaaatggc
gccgacgagctgatcctgaccgacgacaacccccgcaccgagtcaccggcggccattatc
tccgatatgcaggccggactcagtgcaccgaataccgccagggtgattcactcccgggcc
gaggccattgcctatgccgtgggcgcagcgaacgagcaggacattattttggtagcaggc
aagggccatgaggattatcagatagtgggtacacagaccttacattacagcgatcgggaa
accgtggccgccgcgctggccgccgcgctgggagcagaccggtga

DBGET integrated database retrieval system