KEGG   Oceanimonas sp. GK1: GU3_04940Help
Entry
GU3_04940         CDS       T01667                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
oce  Oceanimonas sp. GK1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:oce00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:oce00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1075257..1076180)
Genome map
AA seq 307 aa AA seqDB search
MANPLYQKHVISISDFTRAELELVIDTAVMLKTHPRPELLKHKVVASCFFEASTRTRLSF
ETAVHRLGGAVIGFSDSGSTSLAKKGETLADSVKIISSYSDAFVMRHPQEGAARLAAEFS
SVPVINAGDGSNQHPTQTLLDLFTIYETQGTLQGLTVAFVGDLKYGRTVHSLTQALSLFG
CKFYFIAPQALAMPDYLCEELVEKGINFEFRDSMEEVMDELDILYMTRVQKERFDETEYM
HVASKYVLTPQVLDNAKDSLKVLHPLPRIDEITVEVDDTPYAYYFEQAENGVYARQALLA
LVLNETL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccctctatatcaaaagcatgtcatttccatatccgactttacccgcgccgag
ctggagctggtcatcgataccgccgtcatgctcaagacccatccccgacccgagctgctg
aagcacaaggtggtggcaagctgcttttttgaagcctccacccgcacccggctgtcattt
gaaaccgccgtgcatcgtctgggcggcgccgtcatcggcttttccgacagcggcagcacc
tcgctggccaaaaagggcgaaaccctggccgactcggtgaagatcatcagctcctacagc
gatgccttcgtgatgcgccaccctcaggaaggcgcggcgcggctggcggcggagttttcc
tcggtgccggtgatcaacgccggcgacggctccaaccagcaccccacccagacgctgctg
gatctgttcaccatctacgaaacccagggcaccctgcaggggctgaccgtggcctttgtg
ggcgacctgaaatacggccgcaccgtgcactcgctcacccaagcactcagcctgttcggc
tgcaaattctactttatcgctccccaggccctggccatgcccgactacctgtgcgaggag
ctggtggaaaaaggcatcaacttcgaattccgcgacagcatggaagaggtgatggacgag
ctcgacattctgtacatgacccgggtgcagaaggagcggtttgacgaaaccgaatacatg
cacgtggcctccaaatacgtactgacgccccaggtgctggacaacgccaaggacagcctc
aaggtactgcacccgctgccccgcatcgacgagatcacggtagaggtggacgacaccccc
tacgcctattacttcgagcaggccgaaaacggcgtttacgcccgccaggccctgctggcg
ctggtattgaacgaaaccctgtaa

DBGET integrated database retrieval system