KEGG   Oceanimonas sp. GK1: GU3_05460Help
Entry
GU3_05460         CDS       T01667                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00670  One carbon pool by folate
oce00790  Folate biosynthesis
oce01100  Metabolic pathways
Module
oce_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GU3_05460
   00670 One carbon pool by folate
    GU3_05460
Enzymes [BR:oce01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GU3_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AEY00849
UniProt: H2FZ08
Position
1177022..1177507
Genome map
AA seq 161 aa AA seqDB search
MTLSMIVAMTRDGIIGLNNAMPWHLPADLAYFKQTTLGKPVVMGRNTYESIGRPLPGRRN
VIVSRSLVEAPAGTELVPSPEAALALLAEAEEVMVMGGGQLYAALLPLAQRLYITRIDAR
IDGDTRFPAMNEQEWRLVSEQYRPADERNGYDCRFQVLERM
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtcgatgattgtcgccatgacccgggatggcattattggcctgaataatgcc
atgccttggcacctgccggcggatctggcctatttcaagcagaccaccctgggcaaaccg
gtggtgatggggcgcaatacttatgaatccatcggccgtcccttgccgggacggcgtaat
gtgattgtcagtcgctcccttgttgaggcaccggccggcaccgaactggtgccgtctccc
gaggcggcgctggccctgctggcagaggccgaagaagtgatggtgatgggcgggggccag
ctgtatgccgcgctgctgccgctggctcagcggctctacattacccgtatcgacgcccgc
attgacggtgatacccgtttcccggccatgaatgagcaggaatggcggctggtgagcgag
cagtaccggcccgccgatgagcgcaacggctacgactgtcgctttcaggtgctggaacgg
atgtga

DBGET integrated database retrieval system