KEGG   Oceanimonas sp. GK1: GU3_05560Help
Entry
GU3_05560         CDS       T01667                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
oce  Oceanimonas sp. GK1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GU3_05560
Enzymes [BR:oce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GU3_05560
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GU3_05560
Lipid biosynthesis proteins [BR:oce01004]
 Fatty acid synthase
  Component type
   GU3_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202412..1203014)
Genome map
AA seq 200 aa AA seqDB search
MLRILVLLLCLVSPTVLADTLLILGDSLSAGYRMRSDQAWPHLLAEQWRREGRQVTVINA
SVSGDTTQGGLQRLPPLLQRHQPSLVLLELGGNDGLRGLPPGLIERNLERLIALAGDAGA
RVILTDIQLPPNYGRRYLQQFEQVFSRLASQHQLPLLPFFVAPLMGEQGMMMDDGIHPTV
KAQPLIARQVGEFLTPYLTP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatccttgtgctgttgctgtgtctggtgtcgcccacggtactggccgacacc
ctgcttattctgggcgacagcctgagtgccggctatcgcatgcgttcggatcaggcctgg
ccccacctgctggccgagcagtggcggcgggagggccggcaggtcaccgtcatcaatgcc
agcgtcagcggcgacaccacgcagggcggcctgcaacggctgccgcccctgctgcaacgg
catcagcccagcctggtactgctggagctgggcggcaatgatggtctgcgtggtctgcct
cccgggctgattgagcgcaacctggagcggttaatagcgctggccggcgatgccggtgcc
cgggttattctcaccgacattcaactgccgcccaactatggccggcgctacctgcagcag
ttcgaacaggtattcagccggctggcgagtcagcaccagttgcccctgctgccgtttttc
gtggcgccactgatgggtgagcagggcatgatgatggacgacggcattcatcccaccgtt
aaagcccagccgctgattgcccggcaggtgggcgagtttctcaccccctatctgacgccc
tag

DBGET integrated database retrieval system