KEGG   Oceanimonas sp. GK1: GU3_06250Help
Entry
GU3_06250         CDS       T01667                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00900  Terpenoid backbone biosynthesis
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GU3_06250 (ipk)
Enzymes [BR:oce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GU3_06250 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR Phageshock_PspD
Motif
Other DBs
NCBI-ProteinID: AEY01006
UniProt: H2FY49
Position
complement(1350714..1351541)
Genome map
AA seq 275 aa AA seqDB search
MRLPAPAKLNLFLYITGRRPDGYHNLQTLFQFVDFGDELAFTPAPELMLSPPLPGVALED
NLIIRAARLLQAHTGCPQGAHIHLTKRLPMGGGLGGGSSDAATTLVGLNRLWRLGLAKHE
LADLGRQLGADVPVFIHGHAAFAEGVGDIFTAASPPEPWYLVLNPGVEVATPAIFNDPAL
PRNSPVLSLEQRLSSPWQNDCEGLVKMRHPEVAKLLSWLLEYAPSRMTGTGACVFGTFDR
REAAEQALKKAPAGARGFVAKGCNRSPLLTALDAL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccgcccccgccaagctcaacctgtttctgtacatcaccggccgccggcct
gacggttaccacaacctgcagaccctgtttcagtttgtggactttggcgacgaactcgcc
tttacgcccgcccccgagctgatgctgagcccgcccttgcccggggtggccctcgaagac
aacctgattattcgtgccgcgcgcctgctgcaggcgcatactggctgtccccaaggtgcg
cacattcatcttaccaagcgcctgcccatgggtggcggtcttggcgggggctccagcgat
gccgccaccaccctggtggggctgaaccggctgtggcggctgggcctagccaagcacgaa
ctcgccgatctcggccggcagttgggggccgacgtgccggtgttcatccatggccacgcc
gcctttgccgagggcgtaggggatattttcaccgccgccagcccgcccgaaccctggtat
ctggtgctcaacccgggggtggaagtggccacgccggccatcttcaacgacccggcattg
ccccgcaacagcccggtgctgagcctggaacaacggctgtcttccccctggcaaaacgac
tgcgaagggctggtcaaaatgcgacaccccgaggttgccaaacttctgagctggttgcta
gaatatgcgccgtcacgaatgacgggcaccggcgcctgtgttttcggcacctttgaccgt
cgcgaagcggcggaacaggcgctgaaaaaagcgccggccggcgcccgcggttttgttgcc
aaaggctgcaaccgctcgccgctgctgacggcactggacgccctttga

DBGET integrated database retrieval system