KEGG   Oceanimonas sp. GK1: GU3_06460Help
Entry
GU3_06460         CDS       T01667                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00630  Glyoxylate and dicarboxylate metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01200  Carbon metabolism
Module
oce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GU3_06460
Enzymes [BR:oce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GU3_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Nuc_rec_co-act
Motif
Other DBs
NCBI-ProteinID: AEY01048
UniProt: H2FZ97
Position
1394255..1395853
Genome map
AA seq 532 aa AA seqDB search
MPYANEIDTLTTLLKQNPTWGAIKPEHAARMRVQNQFKTGLDIAKYTAKIMRADMAAYDA
DPSQYTQSLGCWHGFIGQQKLISIKKHFGSTKGRYLYLSGWMVAALRSEFGPLPDQSMHE
KTSVPALIEELYTFLRQADSWELNHLFRALEDAQKAGDAAKVKNIEAQIDNHQTHIVPIV
ADIDAGFGNAEATYLLARKMIEAGACCIQLENQVSDEKQCGHQDGKVTVPHADFLAKINA
VRLAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDQYNSFLDGDYINSADEIAN
GDVVIKANGKLKKVKRLASGLFQFKAGSGEDRVVLDCITSLQHGADLLWIETEKPHIGQI
KGMVDRIRAVVPDAKLVYNNSPSFNWTLNFRQQVFDAWAAEGKDVSGYDRDRLMSADYDS
TELALLADEKVRTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGDEGMLAYVAG
VQRQEIRQGIATVKHQDMAGSNIGDDHKEFFAGDAALKAGGKDNTMGQFENI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgccaacgagatcgataccctgaccacactgctcaagcagaacccgacctgg
ggcgccatcaaacccgagcatgccgcccgcatgcgggtgcagaaccaattcaagaccggc
ctcgacattgccaaatacaccgccaaaatcatgcgggcagacatggccgcctatgatgcg
gatccgtcccagtacactcagtctctgggctgctggcatggctttatcggtcagcagaag
ctgatctccatcaagaagcactttggcagcaccaagggtcgttacctgtatctgtccggc
tggatggtggccgcgctgcgctccgagttcggccccctgccggatcagtccatgcacgag
aaaacctcggtgccggccctgattgaagagctgtacaccttcctgcgccaggccgactcc
tgggagctgaatcacctgttccgtgccctggaagacgcccagaaggccggtgatgctgcc
aaagtgaagaacattgaagcccagatcgacaaccaccagactcatatcgtgcccattgtg
gcggacatcgacgccggttttggtaacgccgaggccacctacctgctggccagaaagatg
attgaagccggtgcctgctgtattcagctggaaaaccaggtgtccgacgagaagcagtgc
ggccaccaggacggcaaggtcaccgtgccccacgccgacttcctggccaagatcaatgcc
gtgcgcctggccttcctcgagctgggcgtggacgacggtgtcattgtggcccgtaccgac
tctttgggtgccggtctgaccaaacagattgccgtgaccaacgagccgggcgatctggga
gatcagtacaacagcttcctggacggcgactacatcaacagcgccgacgaaatcgccaac
ggcgacgtggtcatcaaggccaacggcaaactgaaaaaggtcaagcgcctggcttccggt
ctgttccagttcaaggccggctccggtgaagaccgggtggtactggactgcatcaccagc
ctgcagcacggcgccgacctgctgtggattgaaactgagaagccccacatcggccagatc
aagggcatggtggaccgcattcgcgccgtggtgcctgatgccaagctggtgtacaacaac
agcccgtcctttaactggaccctgaacttccgtcagcaggtgttcgatgcctgggccgcc
gaaggcaaggacgtgtccggctacgatcgggatcgcctgatgagcgccgattacgacagc
accgagctggccctgctggccgacgagaaggtgcggaccttccaggccgacgccgcccgg
gaagccggcatcttccaccacctgatcaccctgccgacctaccacaccgcggcgctgtct
accgacaacctggccaagggctacttcggggacgaaggcatgctggcctacgtggcgggc
gtgcagcgtcaggaaattcgtcagggcattgccaccgtcaagcaccaggacatggccggc
tccaacatcggtgacgatcacaaggagttcttcgccggtgacgccgccctcaaggccggc
ggtaaagacaacaccatgggtcagttcgaaaacatctga

DBGET integrated database retrieval system