KEGG   Oceanimonas sp. GK1: GU3_07005Help
Entry
GU3_07005         CDS       T01667                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
oce  Oceanimonas sp. GK1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GU3_07005
   00330 Arginine and proline metabolism
    GU3_07005
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GU3_07005
Enzymes [BR:oce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GU3_07005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518891..1519805
Genome map
AA seq 304 aa AA seqDB search
MTLQPLLDRIDSQARRHIGLGKVADYIPALARVPAERFGMAICTLDGELYCSGDAREPFS
IQSMSKAFALAMAQQRYGDELWQRVGKEPSGNAFNSLVQLEFEQGIPRNPFINAGALVVV
DALSSRLSAPVHAFLEAMRLRAGNPGIRIDHKVADSEYDHRFRNAAMANLMKSFGNFRNE
VDEVLKAYFSYCALSMSCVDLARAFSFLANGGRCVVTGEQWLSRLQTQQLNALLFTSGLY
DAAGDFAYRVGMPAKSGVGGGIVAVVPGRFTVCVWSPELNCYGNSVAGIWALEELSRALD
LRLF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgacacttcaacccttacttgatcggatagactcccaggcccgccggcatattggcctg
ggcaaggtggccgactacattcccgccctggcgcgggtgcccgccgagcgcttcggcatg
gccatctgtaccctggacggcgagctgtattgcagtggcgacgcccgggagcccttttcc
atccagagcatgtccaaggccttcgccctggccatggcccagcaacgctatggcgacgag
ctgtggcagcgggtcggcaaggagccgtcgggcaatgccttcaactccctggtacagctg
gagtttgagcagggcataccgcgtaatccctttatcaacgccggcgccctggtggtggtg
gatgcgctcagctcccgcctgtcggccccggtgcacgcctttctggaagcgatgcggttg
cgggccggcaatccgggaatacgcattgaccacaaggtcgccgactctgaatacgatcac
cgctttcgcaatgcggccatggccaacctgatgaaaagctttggcaacttccgcaatgag
gtggacgaggtgctgaaggcctatttcagctattgtgccttgtccatgagctgcgtggat
ctggcccgggccttcagctttctggccaatggcggtcgctgcgtggtgaccggcgagcag
tggctgtcccggctgcagacccagcagctcaacgccctgctgttcacctcgggactctac
gatgcagccggcgatttcgcctaccgggtaggcatgccggccaagtccggagtggggggc
ggtatagtggcggtggtgccgggacgcttcacggtgtgcgtctggtcgccggagctgaac
tgctacggcaattcggtggcggggatctgggcgctggaagagctgtcccgggcactggac
ttacgacttttctga

DBGET integrated database retrieval system