KEGG   Oceanimonas sp. GK1: GU3_07260Help
Entry
GU3_07260         CDS       T01667                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
oce  Oceanimonas sp. GK1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GU3_07260
Enzymes [BR:oce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GU3_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577103..1577945
Genome map
AA seq 280 aa AA seqDB search
MLLSSASRTLDLSTPQVMGILNITPDSFSDGGRYHSQDAALRHALQMVADGATMIDVGGE
STRPGADEVVEQEELDRVVPVVERLRAELDCWISVDTSKAVVMRETVRAGADLINDIRAL
REPGTLEVAAASGAAVCLMHMQGQPRTMQQAPDYDDVAAEVADFLVQRLAVCEAAGIPRE
RVCLDPGYGFGKSLEHNYELLGRLGELHRLGLPLLVGMSRKSMLGQLLNREVNERLAGTL
AAHLFAVAQGAQIVRVHDVKDMVDALRVWRKAAQYQEQSA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttgttatcttccgcatccagaacgctggatctctccacgccccaggtgatgggcata
ctcaatatcactcccgactctttttccgatggcggtcgttatcacagccaggatgcggcc
ctgcgtcatgccctgcaaatggtcgccgacggtgccaccatgattgacgtgggcggcgag
tcgacccgccccggtgccgatgaggtggtggagcaggaagagctggaccgggtggtgccg
gtggtggagcggctcagagccgaactggactgctggatttccgtggataccagcaaggca
gtggtgatgcgcgaaacggtcagggccggcgccgatttgattaacgacattcgtgccctg
cgcgagcccggcacgctggaagtggccgctgccagcggggccgccgtgtgcctgatgcac
atgcaggggcagccccgtaccatgcagcaggcgccggactatgacgatgtggccgccgag
gtggctgattttctcgtacagcggctggcggtctgcgaggcggcgggcattccccgcgaa
cgcgtttgcctggatccggggtatggctttggcaagtcgctggagcacaactatgaactg
ctgggccgactcggtgagctgcaccggctcggactgccgctgctggtgggcatgtcccgc
aaatcgatgctgggccagctgctcaatcgcgaggtcaacgaacgcctggccggcaccctg
gccgcgcatctgtttgcggtggcccagggagcccagatagtccgggttcatgatgttaag
gacatggttgatgcccttcgtgtatggcgaaaggcggcacagtatcaggaacaaagtgca
tga

DBGET integrated database retrieval system