KEGG   Oceanimonas sp. GK1: GU3_07260Help
Entry
GU3_07260         CDS       T01667                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
oce  Oceanimonas sp. GK1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577103..1577945
Genome map
AA seq 280 aa AA seqDB search
MLLSSASRTLDLSTPQVMGILNITPDSFSDGGRYHSQDAALRHALQMVADGATMIDVGGE
STRPGADEVVEQEELDRVVPVVERLRAELDCWISVDTSKAVVMRETVRAGADLINDIRAL
REPGTLEVAAASGAAVCLMHMQGQPRTMQQAPDYDDVAAEVADFLVQRLAVCEAAGIPRE
RVCLDPGYGFGKSLEHNYELLGRLGELHRLGLPLLVGMSRKSMLGQLLNREVNERLAGTL
AAHLFAVAQGAQIVRVHDVKDMVDALRVWRKAAQYQEQSA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttgttatcttccgcatccagaacgctggatctctccacgccccaggtgatgggcata
ctcaatatcactcccgactctttttccgatggcggtcgttatcacagccaggatgcggcc
ctgcgtcatgccctgcaaatggtcgccgacggtgccaccatgattgacgtgggcggcgag
tcgacccgccccggtgccgatgaggtggtggagcaggaagagctggaccgggtggtgccg
gtggtggagcggctcagagccgaactggactgctggatttccgtggataccagcaaggca
gtggtgatgcgcgaaacggtcagggccggcgccgatttgattaacgacattcgtgccctg
cgcgagcccggcacgctggaagtggccgctgccagcggggccgccgtgtgcctgatgcac
atgcaggggcagccccgtaccatgcagcaggcgccggactatgacgatgtggccgccgag
gtggctgattttctcgtacagcggctggcggtctgcgaggcggcgggcattccccgcgaa
cgcgtttgcctggatccggggtatggctttggcaagtcgctggagcacaactatgaactg
ctgggccgactcggtgagctgcaccggctcggactgccgctgctggtgggcatgtcccgc
aaatcgatgctgggccagctgctcaatcgcgaggtcaacgaacgcctggccggcaccctg
gccgcgcatctgtttgcggtggcccagggagcccagatagtccgggttcatgatgttaag
gacatggttgatgcccttcgtgtatggcgaaaggcggcacagtatcaggaacaaagtgca
tga

DBGET integrated database retrieval system