KEGG   Oceanimonas sp. GK1: GU3_07375Help
Entry
GU3_07375         CDS       T01667                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00260  Glycine, serine and threonine metabolism
oce00750  Vitamin B6 metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01230  Biosynthesis of amino acids
Module
oce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GU3_07375
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GU3_07375
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GU3_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEY01231
UniProt: H2FSX4
Position
1605604..1606878
Genome map
AA seq 424 aa AA seqDB search
MKLYNIKDNAETINFAGAVKQGLGRGQGLFFPEQLSPLANVDALLELPLVPRSVAILQHL
IGDEIPADTLTAMVEHAFTFPAPLVKVDEHTYALELFHGPTLAFKDFGGRFMAQCLATLR
SDGKITILTATSGDTGAAVAHAFYGLPNIDVVILYPEGKISPLQEKLFTTLGGNIRTFAV
KGDFDACQALVKQAFDDEELKATVGLNSANSINISRLLAQVCYYFEAVAELPAEQRHKAV
ISVPSGNFGNLTAGLIAKAIGLPVKRFVAATNANDTVPRYLDSGNWAPNETVATLSNAMD
VSRPNNWPRVEELCRVKGWSLSDIASGALNDEQTKDALKRLFAKGYLCEPHGAIAWDLLN
KERGKDEVGIFLCTAHPAKFKESVDAILEQDIALPGPLAKHGAMASLSETIPADFAVLKA
KMMD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacaatatcaaggataacgccgagaccatcaattttgccggggccgtcaag
cagggcctgggccgcggccagggcctgttctttccggagcagttaagcccgctggccaat
gtggatgccctgctggagctgccgctggtgccgcgctccgtggccattctgcagcacctg
atcggggatgaaattcctgccgataccctcaccgccatggtggagcacgcctttaccttc
ccggcgccgctggtgaaggtggacgagcacacctatgccctggagctgttccacggcccg
accctggcgttcaaggacttcggcggccgcttcatggcccagtgcctggccaccctgcgc
agcgacggcaagatcaccattctcaccgccacctccggcgacaccggtgccgccgtggcc
cacgccttctacggcctgcccaatatcgacgtggtgatcctgtatccggaaggcaaaatc
agcccgctgcaggaaaagctgtttaccaccctgggcggcaatattcgcacctttgcagta
aagggcgacttcgatgcctgtcaggccctggtcaagcaggcctttgacgacgaagagctg
aaggccaccgtgggcctgaactccgccaactccatcaacatcagccggctgctggcccag
gtgtgttattactttgaagccgtggccgagctgcccgccgagcagcgccacaaggcggtg
atcagcgtgccgtccggcaacttcggcaacctcaccgcgggcctgattgccaaggccatc
ggcctgccggtgaagcgctttgtggccgccaccaacgccaacgacaccgtgccgcgttac
ctggacagcggcaactgggcccccaacgagacggttgctaccctgtccaacgccatggac
gtgagccggcccaacaactggccgcgggtggaagagctgtgccgggtcaagggctggagc
ctgtccgacatcgcctccggtgcgcttaacgacgagcagactaaagacgcgctcaagcgg
ctgtttgccaagggctacctgtgcgagccccacggcgccatcgcctgggatctgctcaac
aaagagcggggcaaggatgaggtgggcattttcctgtgcaccgcccatccggccaagttc
aaggaaagtgtggatgccattctcgagcaggacattgcactgccggggccgctggccaag
cacggcgccatggcgtctctgtccgagaccattcccgccgacttcgccgtgctcaaggcg
aaaatgatggactga

DBGET integrated database retrieval system