KEGG   Oceanimonas sp. GK1: GU3_07375Help
Entry
GU3_07375         CDS       T01667                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GU3_07375
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GU3_07375
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GU3_07375
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GU3_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605604..1606878
Genome map
AA seq 424 aa AA seqDB search
MKLYNIKDNAETINFAGAVKQGLGRGQGLFFPEQLSPLANVDALLELPLVPRSVAILQHL
IGDEIPADTLTAMVEHAFTFPAPLVKVDEHTYALELFHGPTLAFKDFGGRFMAQCLATLR
SDGKITILTATSGDTGAAVAHAFYGLPNIDVVILYPEGKISPLQEKLFTTLGGNIRTFAV
KGDFDACQALVKQAFDDEELKATVGLNSANSINISRLLAQVCYYFEAVAELPAEQRHKAV
ISVPSGNFGNLTAGLIAKAIGLPVKRFVAATNANDTVPRYLDSGNWAPNETVATLSNAMD
VSRPNNWPRVEELCRVKGWSLSDIASGALNDEQTKDALKRLFAKGYLCEPHGAIAWDLLN
KERGKDEVGIFLCTAHPAKFKESVDAILEQDIALPGPLAKHGAMASLSETIPADFAVLKA
KMMD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacaatatcaaggataacgccgagaccatcaattttgccggggccgtcaag
cagggcctgggccgcggccagggcctgttctttccggagcagttaagcccgctggccaat
gtggatgccctgctggagctgccgctggtgccgcgctccgtggccattctgcagcacctg
atcggggatgaaattcctgccgataccctcaccgccatggtggagcacgcctttaccttc
ccggcgccgctggtgaaggtggacgagcacacctatgccctggagctgttccacggcccg
accctggcgttcaaggacttcggcggccgcttcatggcccagtgcctggccaccctgcgc
agcgacggcaagatcaccattctcaccgccacctccggcgacaccggtgccgccgtggcc
cacgccttctacggcctgcccaatatcgacgtggtgatcctgtatccggaaggcaaaatc
agcccgctgcaggaaaagctgtttaccaccctgggcggcaatattcgcacctttgcagta
aagggcgacttcgatgcctgtcaggccctggtcaagcaggcctttgacgacgaagagctg
aaggccaccgtgggcctgaactccgccaactccatcaacatcagccggctgctggcccag
gtgtgttattactttgaagccgtggccgagctgcccgccgagcagcgccacaaggcggtg
atcagcgtgccgtccggcaacttcggcaacctcaccgcgggcctgattgccaaggccatc
ggcctgccggtgaagcgctttgtggccgccaccaacgccaacgacaccgtgccgcgttac
ctggacagcggcaactgggcccccaacgagacggttgctaccctgtccaacgccatggac
gtgagccggcccaacaactggccgcgggtggaagagctgtgccgggtcaagggctggagc
ctgtccgacatcgcctccggtgcgcttaacgacgagcagactaaagacgcgctcaagcgg
ctgtttgccaagggctacctgtgcgagccccacggcgccatcgcctgggatctgctcaac
aaagagcggggcaaggatgaggtgggcattttcctgtgcaccgcccatccggccaagttc
aaggaaagtgtggatgccattctcgagcaggacattgcactgccggggccgctggccaag
cacggcgccatggcgtctctgtccgagaccattcccgccgacttcgccgtgctcaaggcg
aaaatgatggactga

DBGET integrated database retrieval system