KEGG   Oceanimonas sp. GK1: GU3_07505Help
Entry
GU3_07505         CDS       T01667                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oce  Oceanimonas sp. GK1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GU3_07505
   00052 Galactose metabolism
    GU3_07505
   00500 Starch and sucrose metabolism
    GU3_07505
   00520 Amino sugar and nucleotide sugar metabolism
    GU3_07505
Enzymes [BR:oce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GU3_07505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631512..1632480)
Genome map
AA seq 322 aa AA seqDB search
MAERGSFGYDTGFVFNGDDPMSHQQSIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPL
IQYVVNEAVQAGIKEIVLVTHASKNSIENHFDTSFELEATLEKRVKRQLLSEVQNICPPD
VTIMHVRQGEARGLGHAILCARPLVGDAPFAILLPDVLIDDAACDLGRDNLAAMIAAFDE
TGHSQILVEPVADALVDQFGIVDLGNASLAQGESAAITAMVEKPAREEAPSNLSVVGRYV
LPASIWPLLQKTPLGKGDEIQLTDTIAMLMDKERVDAHHITGKSHDCGSKLGYMKANVEY
GLRHKELGEDFRRYLQQLLPAQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaaggggcagctttggttatgataccggctttgttttcaacggcgatgatccc
atgtcacaccaacaatccattcgcaaggccgtgatccccgtggccggcctcggcacccgc
atgctgcccgccaccaaggccattcccaaggaaatgctgccggtggtcgacaagccgctt
atccagtacgtggtcaacgaggccgttcaggccggtatcaaggaaattgtgctggtcacc
cacgccagtaagaactccattgaaaaccatttcgacaccagctttgagctggaagccacc
ctggaaaaacgggtcaagcgccagctgctgagtgaagtgcagaacatctgcccgcccgat
gtcaccatcatgcatgtgcgtcagggcgaggcccggggcctggggcacgccattctctgt
gcccgcccgctggtgggggatgccccctttgccattctgctgcccgacgtgctgatcgac
gatgccgcctgcgatctgggccgggataacctggccgccatgatcgccgcctttgatgaa
accggccacagccagatcctggtggagccggtggccgacgcgctggtggatcagtttggt
attgtcgacctgggtaacgccagcctggcccagggcgagtcggcggccattaccgccatg
gtggaaaaaccggcccgggaagaggcgccgtcaaacctgtcggtcgtgggccgttatgtg
ctgccggccagcatctggccgctgctgcaaaaaaccccgctgggcaagggcgacgaaatt
cagctgaccgataccatcgccatgctgatggacaaggagcgggttgatgcccaccacatt
accggcaaaagccacgattgcggcagcaagctgggctacatgaaagccaatgtggaatat
ggcctgcgccacaaggagctgggcgaagattttcgccgctatctgcaacagctgttgccg
gctcagtaa

DBGET integrated database retrieval system