KEGG   Oceanimonas sp. GK1: GU3_07780Help
Entry
GU3_07780         CDS       T01667                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00625  Chloroalkane and chloroalkene degradation
oce00680  Methane metabolism
oce01100  Metabolic pathways
oce01120  Microbial metabolism in diverse environments
oce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    GU3_07780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GU3_07780
Enzymes [BR:oce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     GU3_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 FAD_binding_2 XdhC_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEY01312
UniProt: H2FTD3
Position
1687842..1689038
Genome map
AA seq 398 aa AA seqDB search
MCAIHGNRGVVYTGPGKVEVQSIAFPELSLGNRACHHGVILKVVSTNICGSDQHMVRGRT
TAPSGLVLGHEITGQIIECGRDVEFLKVGDIVSVPFNIACGRCRNCKEGKTGICLNVNPA
RPGAAYGYVDMGGWVGGQSEYVMVPYADFNLLKFPDPNQALEKIRDLTLLSDIFPTGFHG
CVTAGVGPGSTVYIAGAGPVGLAAAASAQLLGAACVIVGDMNPERLAQARSFGCETIDLR
EEGSMEDKLEVILGEREVDAFVDCVGFEAHACGCNHGKEAPATVLNSAMQITRAGGQIGI
PGLYVTEDPGAVDAAAREGALSMRFGLGWAKSHSLHTGQCPVMKYHRPLMQAILFDKVQI
AKAVNVQVISLDQAVQGYADFDGGVAKKFVIDPHGMVA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgatacacggtaacaggggtgtggtttataccggtcccggcaaggtcgaggtc
cagtccatcgcctttcccgagctgtctctgggcaacagggcctgccaccacggggtgatc
ctcaaggtggtgtccaccaatatctgcggcagcgaccagcacatggtacgcggccgcacc
acggcgccttccggcctggtgctgggccacgagatcaccggccagatcattgaatgcggt
cgggatgtggagtttctcaaggtgggcgacattgtgtcggtgccgttcaatattgcctgc
ggccgctgccgcaactgcaaggaaggcaaaaccggcatctgcctgaacgtgaacccggcc
cgtcccggcgctgcctacggctacgtcgacatgggcggctgggtcggtggccagtccgaa
tacgtgatggtgccctacgccgacttcaacctgctgaagttcccggatcccaaccaggcg
ctggaaaagattcgcgatctgaccctgctgtcggacatcttccccaccggtttccacggc
tgcgtgactgccggcgtgggcccgggctccaccgtctacattgccggggccggcccggtc
ggtctggccgccgccgcctcagcccagctgctgggtgccgcctgcgtgatcgtgggcgac
atgaatccggagcgcctggcccaggcccgcagctttggctgcgaaaccatcgatctgcgt
gaagagggctcgatggaagacaagctggaggtcattctgggcgagcgggaagtggacgcc
tttgtggactgcgttggcttcgaggcccatgcctgtggctgcaaccacggcaaggaggcc
ccggccaccgtgctcaactcggccatgcaaatcacccgcgccggcggccagattggcatt
cccggcctgtacgtgaccgaagatccgggcgcggtggacgcagcggccagagagggcgcg
cttagcatgcgctttggtctgggctgggccaagtcccactccctgcacaccggtcagtgt
ccggtgatgaagtatcaccgccccctgatgcaggctattctgttcgacaaggtgcaaatc
gccaaggcggtaaacgtgcaggtgatttccctggatcaagcggtacagggctatgccgac
ttcgacggcggcgtggccaagaagtttgtcattgacccccatggcatggtggcctga

DBGET integrated database retrieval system