KEGG   Oceanimonas sp. GK1: GU3_09290Help
Entry
GU3_09290         CDS       T01667                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
oce  Oceanimonas sp. GK1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GU3_09290
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GU3_09290
   00650 Butanoate metabolism
    GU3_09290
  Energy metabolism
   00190 Oxidative phosphorylation
    GU3_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017803..2018147
Genome map
AA seq 114 aa AA seqDB search
MVTNSATFGRSGVHDFMLLRATAVLLTLYTLYLVGFIAFNDITYQVWTGFFDRTFTKVFT
LLALFSVLMHGWIGAWQVLSDYVKPALWRGLAQFAVVVLLLSYLLTGIVVLWGV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattctgcaacttttggccgcagcggcgtgcacgattttatgctgcttcgt
gccactgctgtccttctgaccctgtacaccctgtatctggtcggcttcattgcctttaac
gacatcacctatcaggtgtggacgggcttttttgaccgtaccttcaccaaggtgtttacc
ctgctggcgctgttcagtgtgctgatgcacggctggattggtgcctggcaggtgctgtcc
gactacgtcaagccggcgctgtggcgcggcctggcccagtttgccgtggtggtgttgctg
ctgtcctatctgctgaccggtatcgttgtattgtggggtgtataa

DBGET integrated database retrieval system