KEGG   Oceanimonas sp. GK1: GU3_09290Help
Entry
GU3_09290         CDS       T01667                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00020  Citrate cycle (TCA cycle)
oce00190  Oxidative phosphorylation
oce00650  Butanoate metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
Module
oce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oce_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GU3_09290
   00650 Butanoate metabolism
    GU3_09290
  Energy metabolism
   00190 Oxidative phosphorylation
    GU3_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AEY01614
UniProt: H2FV55
Position
2017803..2018147
Genome map
AA seq 114 aa AA seqDB search
MVTNSATFGRSGVHDFMLLRATAVLLTLYTLYLVGFIAFNDITYQVWTGFFDRTFTKVFT
LLALFSVLMHGWIGAWQVLSDYVKPALWRGLAQFAVVVLLLSYLLTGIVVLWGV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattctgcaacttttggccgcagcggcgtgcacgattttatgctgcttcgt
gccactgctgtccttctgaccctgtacaccctgtatctggtcggcttcattgcctttaac
gacatcacctatcaggtgtggacgggcttttttgaccgtaccttcaccaaggtgtttacc
ctgctggcgctgttcagtgtgctgatgcacggctggattggtgcctggcaggtgctgtcc
gactacgtcaagccggcgctgtggcgcggcctggcccagtttgccgtggtggtgttgctg
ctgtcctatctgctgaccggtatcgttgtattgtggggtgtataa

DBGET integrated database retrieval system