KEGG   Oceanimonas sp. GK1: GU3_09310Help
Entry
GU3_09310         CDS       T01667                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00020  Citrate cycle (TCA cycle)
oce00310  Lysine degradation
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
Module
oce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GU3_09310
  Amino acid metabolism
   00310 Lysine degradation
    GU3_09310
Enzymes [BR:oce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GU3_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEY01618
UniProt: H2FV59
Position
2023571..2024779
Genome map
AA seq 402 aa AA seqDB search
MSIEIKVPDLPESVADATIATWHKQPGDSVERDEVIVDIETDKVVLEVPAPEAGILEAIM
EDAGATVLGQQVIGKLKQGAKAGEETKDKPASNGEAKAEAAAAESDDLSPAVRRLVAEHN
IDASKLSGSGKGGRITKEDVEAFIKDGGKAKTADQPVAAKAELPLVAPGQRDQKRVPMTR
LRKRVAERLLEAKNTTAMLTTFNEVNMKPIMDLRKQYQDIFEKRHGIRLGFMSFYVKAVV
ESLKRFPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDCDRLSLADIEKSIKELA
IKGRDGKLTVDDMTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVSFLVSIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaatcaaggttcccgacctccccgaatccgttgccgacgccaccatcgcc
acctggcacaagcagcccggcgacagcgtagagcgcgacgaagtgatcgtcgatattgaa
accgacaaggtggtactggaagtgccggcccccgaggccggtattctggaagccatcatg
gaagacgccggcgccaccgtgctgggtcagcaggtaatcggcaagctcaagcagggcgcc
aaggccggtgaagagaccaaggacaagcccgccagcaacggtgaagccaaggccgaggcc
gcggctgccgagagcgacgatctgagcccggcggtacgccgcctggtggccgagcacaac
attgacgcgagcaagctgtccggctccggcaagggtggccgcatcaccaaggaagacgtg
gaagccttcatcaaggacggcggcaaggccaaaaccgccgaccagccggtcgccgccaag
gccgagctgccgctggtggcgccgggtcagcgcgatcaaaaacgcgtacccatgacccgt
ctgcgcaagcgggtggccgagcgtctgctggaagccaagaacaccaccgccatgctgacc
accttcaacgaggtcaacatgaagccgatcatggatctgcgcaagcagtaccaggacatc
ttcgagaagcgtcacggcattcgcctgggctttatgtccttctacgtgaaggcggtggtg
gagtcgctcaagcgcttcccggaagtgaacgcctccattgacggcgacgatatcgtttat
cacaactactttgatgtcagtattgccgtgtccacgccccgtggcctggtgaccccggta
ctgcgcgactgcgatcgcctgagcctggccgacattgagaagagcatcaaagagctggcc
atcaagggtcgcgacggcaaactgaccgtcgatgacatgaccggcggtaactttaccatt
accaatggcggcgtgttcggctccctgatgtccacccccatcatcaacccgccgcagagc
gccattctgggaatgcacaagatccaggacaggcccatggcggtggacggcaaggtggaa
atcctgccgatgatgtacctggccctgtcttacgatcaccgtctgatcgacggtcgcgag
tcggtcagcttcctggtatcgatcaaggagctgctggaagacccgacccgtctgctgctg
gacgtgtaa

DBGET integrated database retrieval system