KEGG   Oceanimonas sp. GK1: GU3_09310Help
Entry
GU3_09310         CDS       T01667                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oce  Oceanimonas sp. GK1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:oce01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:oce00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:oce00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2023571..2024779
Genome map
AA seq 402 aa AA seqDB search
MSIEIKVPDLPESVADATIATWHKQPGDSVERDEVIVDIETDKVVLEVPAPEAGILEAIM
EDAGATVLGQQVIGKLKQGAKAGEETKDKPASNGEAKAEAAAAESDDLSPAVRRLVAEHN
IDASKLSGSGKGGRITKEDVEAFIKDGGKAKTADQPVAAKAELPLVAPGQRDQKRVPMTR
LRKRVAERLLEAKNTTAMLTTFNEVNMKPIMDLRKQYQDIFEKRHGIRLGFMSFYVKAVV
ESLKRFPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDCDRLSLADIEKSIKELA
IKGRDGKLTVDDMTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVSFLVSIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaatcaaggttcccgacctccccgaatccgttgccgacgccaccatcgcc
acctggcacaagcagcccggcgacagcgtagagcgcgacgaagtgatcgtcgatattgaa
accgacaaggtggtactggaagtgccggcccccgaggccggtattctggaagccatcatg
gaagacgccggcgccaccgtgctgggtcagcaggtaatcggcaagctcaagcagggcgcc
aaggccggtgaagagaccaaggacaagcccgccagcaacggtgaagccaaggccgaggcc
gcggctgccgagagcgacgatctgagcccggcggtacgccgcctggtggccgagcacaac
attgacgcgagcaagctgtccggctccggcaagggtggccgcatcaccaaggaagacgtg
gaagccttcatcaaggacggcggcaaggccaaaaccgccgaccagccggtcgccgccaag
gccgagctgccgctggtggcgccgggtcagcgcgatcaaaaacgcgtacccatgacccgt
ctgcgcaagcgggtggccgagcgtctgctggaagccaagaacaccaccgccatgctgacc
accttcaacgaggtcaacatgaagccgatcatggatctgcgcaagcagtaccaggacatc
ttcgagaagcgtcacggcattcgcctgggctttatgtccttctacgtgaaggcggtggtg
gagtcgctcaagcgcttcccggaagtgaacgcctccattgacggcgacgatatcgtttat
cacaactactttgatgtcagtattgccgtgtccacgccccgtggcctggtgaccccggta
ctgcgcgactgcgatcgcctgagcctggccgacattgagaagagcatcaaagagctggcc
atcaagggtcgcgacggcaaactgaccgtcgatgacatgaccggcggtaactttaccatt
accaatggcggcgtgttcggctccctgatgtccacccccatcatcaacccgccgcagagc
gccattctgggaatgcacaagatccaggacaggcccatggcggtggacggcaaggtggaa
atcctgccgatgatgtacctggccctgtcttacgatcaccgtctgatcgacggtcgcgag
tcggtcagcttcctggtatcgatcaaggagctgctggaagacccgacccgtctgctgctg
gacgtgtaa

DBGET integrated database retrieval system