KEGG   Oceanimonas sp. GK1: GU3_09705Help
Entry
GU3_09705         CDS       T01667                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GU3_09705
Enzymes [BR:oce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GU3_09705
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GU3_09705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113886..2115382)
Genome map
AA seq 498 aa AA seqDB search
MSPQQPYVLALDQGTTSSRAMLFDHNAQLVAMAQREVTQHYPQAGWVEHDATEIWATQRA
TLTEVLAKTGVRPEQLSGIGITNQRETTVLWNRHTGQPIHNAIVWQCRRTAPLCEQLKAA
GLEAEIKTRTGLVPDAYFSATKLRWLLDNVPGARAQAEAGELLFGTIDTWLVWKLTEGRV
HVTDYTNASRTMLFNINTLEWDPLLLKELDIPASLLPEVKPSCAVYGQARLGTGVPIAGM
AGDQQAALFGQLCFHQGMVKNTYGTGCFMLMNTGQKKVESSHGLLTTLAVGADGGVSYAL
EGSVFMGGAVIQWLRDELGLIARAADSEACARKVEDTHGVYLVPAFTGLGAPYWDPYARG
TLVGLTRGANRNHIVRAALEAIAFQSRDLLDAMQQDAGLRLAALKVDGGAAANNFLMQFQ
ADITHSKVIRPQLLESTALGAAFLTGLATGLWHNTNELVQCVSIDREFTPQMDPHHREQH
YQGWQQAVARAQHWAAPS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccaacaaccctatgtgctggcactggatcagggcacgacctcgtcccgggcc
atgctctttgaccacaacgcgcagctggtggccatggcccagcgggaagtgacccagcat
tatccccaggccggctgggtggagcacgacgccaccgagatctgggccacccagcgcgcc
accctcaccgaagtgctggccaaaaccggtgtgcgccccgaacagctcagcggcattggc
attaccaaccagcgggaaaccacggtgctgtggaaccggcacaccggccagcctattcat
aatgccattgtctggcagtgccgacgcaccgctcccctgtgcgagcaactgaaggccgcc
ggcctggaagccgagatcaaaacccgcaccggcctggtgcccgacgcctatttttcggcc
accaaactgcgctggctgctggataacgtgcccggcgccagagcccaggccgaggccggt
gagctgctgtttggcaccatcgacacctggctggtgtggaaactgaccgagggacgggtg
cacgtgaccgactacaccaatgcctcgcgcaccatgctgttcaacatcaacaccctggaa
tgggatcccctgctgctgaaggagctggacattcccgccagcctgctgcccgaggtaaag
ccctcctgcgcggtttatggccaggcccgcctcggtaccggggtgcccattgccggcatg
gccggcgatcagcaggcggcgctgttcggccagctgtgttttcaccagggcatggtgaaa
aacacctacggcaccggctgctttatgctgatgaacaccggccagaaaaaggtggaatcg
tcccatggcctgctcaccaccctggcggtgggcgccgatggcggcgtgagctatgcgctg
gaaggctcggtcttcatgggcggcgccgtgatccagtggctgcgggacgaactcgggctg
attgcccgcgccgccgacagcgaagcctgtgcccggaaggtggaggatacccacggcgtg
tatctggtgccggcctttaccggcctgggcgcgccctactgggacccctacgcccgcggc
accctggtgggcctgacccggggcgccaaccgcaaccatattgtgcgggcagcgctggaa
gccattgcctttcagagccgggatctgctcgacgccatgcagcaggacgccggcctgcgg
ctcgccgcgctgaaagtggacggcggagcggccgccaacaacttcctgatgcaatttcag
gccgacattacccacagcaaggtaatacgcccacaactgctggaaagcaccgccctgggg
gcggcctttctgacggggctggccaccgggttgtggcacaacaccaacgagctggtgcaa
tgtgtgtccatcgaccgggaattcactccgcaaatggatccccaccaccgcgagcagcac
taccaaggctggcaacaggcggtagcccgcgcgcagcactgggcagcgccctcatga

DBGET integrated database retrieval system