KEGG   Oceanimonas sp. GK1: GU3_10575Help
Entry
GU3_10575         CDS       T01667                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GU3_10575 (tpiA)
   01230 Biosynthesis of amino acids
    GU3_10575 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_10575 (tpiA)
   00051 Fructose and mannose metabolism
    GU3_10575 (tpiA)
   00562 Inositol phosphate metabolism
    GU3_10575 (tpiA)
Enzymes [BR:oce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GU3_10575 (tpiA)
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GU3_10575 (tpiA)
  Exosomal proteins of bladder cancer cells
   GU3_10575 (tpiA)
  Exosomal proteins of melanoma cells
   GU3_10575 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303420..2304172
Genome map
AA seq 250 aa AA seqDB search
MRQTLVMGNWKLNGSKTLVRELISALKVPAAEAATVAVAVCPPVLFLGQAEAELAGSVIA
LGAQDADVHTDGAFTGENSPAMYKEFGVKYVLVGHSERRTLHGETDAVVAAKFAAVLEQQ
LVPVLCIGETLAQFEAGETQDVVEAQLQAVIDACGIEALGRAVIAYEPVWAIGTGKTATP
EIAQGVHSAIRAFLAKQHAEVAAGVQILYGGSVKGDSAAGLFAMEDIDGALVGGAALKAD
EFAAIIRAGA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagactctggtaatgggtaactggaaactgaacggcagcaagaccctggtgcgc
gagctgatttctgccctcaaggtgcctgccgccgaggccgccactgtggccgtggccgta
tgcccgccggtgctgtttctgggccaggccgaagccgaactggcaggaagtgtaattgca
ctgggcgctcaggacgccgacgtgcataccgacggcgcctttaccggtgaaaactccccg
gccatgtataaggagtttggcgtgaagtacgtgctggtgggccacagcgaacgccgcacc
ctgcacggtgaaaccgacgccgtggtggccgccaagtttgccgccgtgctggagcagcaa
ctggtgccggtgctgtgcattggcgaaaccctggcgcaatttgaagccggtgaaacgcaa
gacgtggtagaagcccagctgcaggcggtgattgacgcctgcggcatcgaggccctgggc
cgcgccgtgattgcctacgagccggtgtgggccatcggcaccggcaaaaccgccaccccc
gagattgcgcagggtgtgcacagcgccattcgcgcctttctggccaaacaacacgccgag
gtggccgccggcgtgcaaattctctacggtggctcggtcaagggcgacagcgccgccggc
ctgtttgccatggaagacatcgacggtgccctggtgggtggtgcagccctcaaggccgat
gagttcgccgccattatcagggccggcgcataa

DBGET integrated database retrieval system