KEGG   Oceanimonas sp. GK1: GU3_10575Help
Entry
GU3_10575         CDS       T01667                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00010  Glycolysis / Gluconeogenesis
oce00051  Fructose and mannose metabolism
oce00562  Inositol phosphate metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
oce01230  Biosynthesis of amino acids
Module
oce_M00002  Glycolysis, core module involving three-carbon compounds
oce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_10575 (tpiA)
   00051 Fructose and mannose metabolism
    GU3_10575 (tpiA)
   00562 Inositol phosphate metabolism
    GU3_10575 (tpiA)
Enzymes [BR:oce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GU3_10575 (tpiA)
Exosome [BR:oce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GU3_10575 (tpiA)
  Exosomal proteins of bladder cancer cells
   GU3_10575 (tpiA)
  Exosomal proteins of melanoma cells
   GU3_10575 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEY01871
UniProt: H2FW89
Position
2303420..2304172
Genome map
AA seq 250 aa AA seqDB search
MRQTLVMGNWKLNGSKTLVRELISALKVPAAEAATVAVAVCPPVLFLGQAEAELAGSVIA
LGAQDADVHTDGAFTGENSPAMYKEFGVKYVLVGHSERRTLHGETDAVVAAKFAAVLEQQ
LVPVLCIGETLAQFEAGETQDVVEAQLQAVIDACGIEALGRAVIAYEPVWAIGTGKTATP
EIAQGVHSAIRAFLAKQHAEVAAGVQILYGGSVKGDSAAGLFAMEDIDGALVGGAALKAD
EFAAIIRAGA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagactctggtaatgggtaactggaaactgaacggcagcaagaccctggtgcgc
gagctgatttctgccctcaaggtgcctgccgccgaggccgccactgtggccgtggccgta
tgcccgccggtgctgtttctgggccaggccgaagccgaactggcaggaagtgtaattgca
ctgggcgctcaggacgccgacgtgcataccgacggcgcctttaccggtgaaaactccccg
gccatgtataaggagtttggcgtgaagtacgtgctggtgggccacagcgaacgccgcacc
ctgcacggtgaaaccgacgccgtggtggccgccaagtttgccgccgtgctggagcagcaa
ctggtgccggtgctgtgcattggcgaaaccctggcgcaatttgaagccggtgaaacgcaa
gacgtggtagaagcccagctgcaggcggtgattgacgcctgcggcatcgaggccctgggc
cgcgccgtgattgcctacgagccggtgtgggccatcggcaccggcaaaaccgccaccccc
gagattgcgcagggtgtgcacagcgccattcgcgcctttctggccaaacaacacgccgag
gtggccgccggcgtgcaaattctctacggtggctcggtcaagggcgacagcgccgccggc
ctgtttgccatggaagacatcgacggtgccctggtgggtggtgcagccctcaaggccgat
gagttcgccgccattatcagggccggcgcataa

DBGET integrated database retrieval system