KEGG   Oceanimonas sp. GK1: GU3_10580Help
Entry
GU3_10580         CDS       T01667                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GU3_10580
   01230 Biosynthesis of amino acids
    GU3_10580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_10580
   00030 Pentose phosphate pathway
    GU3_10580
   00051 Fructose and mannose metabolism
    GU3_10580
   00052 Galactose metabolism
    GU3_10580
  Energy metabolism
   00680 Methane metabolism
    GU3_10580
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GU3_10580
Enzymes [BR:oce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GU3_10580
Protein phosphatases and associated proteins [BR:oce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GU3_10580
Messenger RNA biogenesis [BR:oce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GU3_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2304347..2305309
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRAVVRTGLHHGLEVFGIQSGYLGLHQDQIVPLDRHSVSD
VITRGGTFLGSARFPEFKQEQVRVEAVQNLKKHGIDGLVVIGGDGSYMGAMCLTEMGFPC
IGIPGTIDNDIAGTDYTIGFDTALNVAVEAIDRLRDTCSSHNRISVVEIMGRHCGDLTSS
AAVAGGAEYVIVPEVAFDQDELIQQIHEGVAKGKKHAIVAICENVCDVNQLARDIQAATG
RDTRATILGHIQRGGTPTASDRIMASRMGARAVELLLEGFGGRCMGLQNNHIVHHDIIDC
IKHLRRPFNEEMYQLSNTLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgcattggggtactcaccagcggcggcgatgcgcccggcatgaacgcggcc
attcgggccgtggtgcgcaccggcctgcatcacggtctggaggtgttcggcattcaaagc
ggctatctcggcctgcatcaggatcagatagttcccctcgaccgccacagcgtgtcggac
gtgatcacccggggcggcacctttctcggctcggcccgctttcccgaattcaagcaggag
caggtacgggttgaggcggtgcagaacctgaaaaaacacggcatcgacggcctggtggtg
atcggcggcgacggctcctacatgggcgccatgtgcctgaccgaaatgggctttccctgc
atcggcattcccggcaccatcgacaacgacattgccggcacagactacaccatcggcttt
gacaccgccctcaacgtggcggtggaagccattgaccggttgcgggacacctgcagctcc
cacaaccgcatttcggtggtggagatcatgggccgccactgcggcgacctcacttcgtct
gccgccgtggccggcggtgccgagtacgtgatcgtgccggaagtggcctttgaccaggat
gagctgatccagcaaatccacgaaggggtggccaaaggcaagaagcacgccattgtggct
atctgcgagaacgtgtgcgacgttaaccagctggcccgggacattcaggccgccaccggc
cgcgatacccgcgccaccattctgggccacattcagcgcggcggcacccccaccgcgtcg
gatcggatcatggccagccgcatgggtgcccgcgccgtggagctgctgctggaaggcttt
ggcggtcgttgcatgggcctgcagaacaaccacatcgtgcaccacgacatcatcgactgc
atcaagcacctgcgccgccccttcaacgaagagatgtatcagctgtcgaatacgctgttc
tga

DBGET integrated database retrieval system