KEGG   Oceanimonas sp. GK1: GU3_11345Help
Entry
GU3_11345         CDS       T01667                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
oce  Oceanimonas sp. GK1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GU3_11345
Enzymes [BR:oce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GU3_11345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2467037..2469031)
Genome map
AA seq 664 aa AA seqDB search
MITTKTPASELLALLDRWVALGWLRPLDRALAGFFAEQQPESEAPVLLAAALASHQLGHG
HVCLDLLATLAEPDFALSLPPEGEEGLADAWLPSKQLATLTLEHWTQALARSPLVAADGE
PARPLVLSGDRLYLRRYWSYEQGVARALAARMQDDRAVPADLANWLERLFPEPLKLDGER
QTDWQKLACALAASSGFTLITGGPGTGKTTTVVRLLALLQGTAAQPLRIRLAAPTGKAAA
RLTESIGAQVASLPVDESVRARIPAEVSTLHRLLGSLPDSRHFRHHAGHPLPLDVLVVDE
ASMIDLEMMHCLLAALPPHARLLLLGDKDQLASVEAGALLGDLCRDAEQGLYTPERLAWL
EAVSGERVVHPSLRPGDAGRHALAQRILMLRYSRRFAGGSGIGRLAEAVNRQQPALARQQ
LEGSDEVATLRLKGEQDAALNRLLFAGRGEGVGYGHYLARLRDERPAAGTAFDGTAWHDW
AKGVLDAFDQFRLLCAVRRGPWGVEGLNARIAGLLHRRGLLEAEEGWYEGRPVLVTRNDY
GLGLMNGDIGIALRLPEQDGSMKLRVAFPRNDGSGGLRFVLPSRLGEVETVFAMTVHKSQ
GSEFAHTALMLPEALNPVLTKELLYTGITRARHRFTLVEPRAGVFEQAIARRVERRSGLL
ESLT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaccaaaacccccgccagcgagctgctggccttgcttgaccgctgggtggcg
ctgggctggctgcgccccctggaccgggcgctggcgggcttttttgccgagcagcagccc
gaaagcgaggcgccggtgctgctggcggcggcactggccagccaccagctcggccacggc
catgtgtgcctggatctgctagcgaccctggccgagccggactttgccctgtcgctgccg
ccggaaggggaagaaggcctggccgatgcctggctgccttcaaagcaactggcgacactg
accctggagcactggacgcaggccctggcccgcagccccctggtggcggccgacggcgag
ccggcgcggcccctggtgctgagtggcgatcgattgtacctgcgtcgttactggagctat
gagcagggggtggcccgggctctggcggcacgcatgcaggatgacagagccgtgcctgcc
gacctggcaaactggcttgagcggttgtttcccgagccgctgaagcttgacggcgagcgc
cagaccgactggcaaaagctggcctgtgccctggcggcgagcagcggctttaccctgatc
accggcggccccggcaccggcaagaccaccactgtggtgcgcctgctggcgctgctgcag
ggcactgccgcccagcccctgcgcattcgactggcggcgcccaccggcaaggcggcggcc
cggctgaccgagtccatcggtgctcaggtggcctcgctgccggtagacgagagcgtgcgc
gcccggatcccggcagaggtgagcaccttgcaccgcttgttgggtagcctgccggacagt
cgtcattttcgtcatcatgccggccacccgctgccgctggatgtgctggtggtggatgag
gcctcgatgatcgatctggaaatgatgcactgcctgctggcggcgttgccgcctcatgcc
cggctgttactgctgggcgacaaggatcagctggcctcggtggaagcgggagccctgctg
ggggacttgtgtcgtgatgccgagcaggggttgtataccccggaacgtctggcctggttg
gaagcggtcagcggcgagcgggtagtgcacccgtccttgcggcccggtgacgccggccgt
catgccctggcccagcgcattctgatgctgcgttactcccgccgctttgccggcggctcc
ggcattggccggctggcagaggcggtgaaccgtcagcagccggcgctggcccggcagcag
ctggagggcagcgacgaggtggctacccttcggctgaagggagagcaggacgcggcgctt
aaccgcctgctgtttgccggtcggggggagggggtgggctatggtcattacctggcacgg
ctgcgggatgaacgtcccgccgccggcaccgcctttgacggtacggcctggcatgactgg
gcaaaaggcgtgctggatgcctttgatcagttccggctgctgtgcgcggtgcgccgaggc
ccctggggggtggaaggtttaaatgcacgcattgccggcctgctgcaccggcgcggcctg
ctcgaggcggaggaaggctggtacgaaggccggccggtactggtgacccgcaacgattac
ggcctggggctgatgaacggggacatcggcattgccctgcgcctgcccgagcaagacggc
agcatgaagctgcgggtggcctttccccgcaacgacggcagcggcggcttgcgttttgtg
ttgcccagccggctgggggaggtggagacggtgttcgccatgacggtacacaagtctcag
ggctcggagtttgcccataccgccctgatgttgcccgaggccctgaacccggtactgacc
aaggagctgctctataccggcattacccgggcccggcaccggtttaccctggtggagccc
cgggccggggtgtttgagcaggccattgcccggcgggtagagcggcgcagcggcctgctg
gagagcctgacctag

DBGET integrated database retrieval system