KEGG   Oceanimonas sp. GK1: GU3_11505Help
Entry
GU3_11505         CDS       T01667                                 

Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
oce  Oceanimonas sp. GK1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GU3_11505
DNA repair and recombination proteins [BR:oce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GU3_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2506707..2507312)
Genome map
AA seq 201 aa AA seqDB search
MRFSPLLDELIKSLQVLPGVGPKSAQRMAFALLERQRAGGRKLAHVLEQALDNIGHCRQC
RTFTEEAVCAICASPKRAVSGQLCVVESPADVVAIEQTGQYQGRYFVLMGHLSPLDGVGP
EDLGLDVLEGWLEAEHFDELILATNPTVEGEATAYFIADIARSQGVAVSRIAHGVPIGGE
LELVDGNTLSHSFMGRKAFSD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcagtccgttactggatgaattaatcaaaagcctgcaggtgttgccgggcgtg
gggcccaagtcggcccagcgcatggcctttgcgctgctggagcgccagcgtgccggtggc
cgcaaactggcccatgtgctggagcaggcactcgataacatcggccactgccgccagtgc
cgtacctttaccgaagaagcggtctgtgccatttgcgccagccccaagcgggcggtctcg
ggccagctgtgcgtggtggaaagccccgccgacgtggtggccattgagcagaccggccag
tatcagggccgttatttcgtgctgatggggcatttgtcgccactggacggcgtggggccg
gaagatctggggctggacgtgctggaaggctggctggaagccgagcattttgacgagcta
atcctggccaccaaccccacggtggaaggggaagctaccgcctactttattgccgacatc
gcccgcagccagggcgtggcggtcagccgcatcgcccacggtgtgcccatcggcggcgag
ctggaactggtggacggcaacaccctcagccattcctttatgggccgcaaggcgttcagc
gactga

DBGET integrated database retrieval system