KEGG   Oceanimonas sp. GK1: GU3_11730Help
Entry
GU3_11730         CDS       T01667                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00010  Glycolysis / Gluconeogenesis
oce00620  Pyruvate metabolism
oce00640  Propanoate metabolism
oce00680  Methane metabolism
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
oce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_11730
   00620 Pyruvate metabolism
    GU3_11730
   00640 Propanoate metabolism
    GU3_11730
  Energy metabolism
   00680 Methane metabolism
    GU3_11730
Enzymes [BR:oce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GU3_11730
Lipid biosynthesis proteins [BR:oce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GU3_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEY02101
UniProt: H2FWW9
Position
complement(2551394..2553178)
Genome map
AA seq 594 aa AA seqDB search
MGFEIITKTPEPSGLRPNLPDYRQGCRQFDWQQARARLKGRDGDINIAFEALDCHVLDGQ
GEQTALVWLSKQGERRTFSYRELQGLSNRFASLLAGLGVVKGETVFSLCGRTPQLYAALL
GSLKAGAVFCPLFSAFGPEPIRSRMEIGNARVLISSARLYQKKVAPWRSELPYLQHVLLY
DCHGDCPAGCLDLDSALAGAAETFYICPTQPEDPALLHFTSGTTGLPKGALHVHEAVVHH
SYSAWCALDLHPGDIYWCTADPGWVTGTSYGVIAPLCNRVTLVVDEAEFDPERWYRILAD
EKVNVWYTAPTAIRMLMKAGDELPARYDLGALRFLASVGEPLNPEAVVWGKRLFGMPFHD
NWWQTETGGIMLANFASEPVKPGSMGQPLPGITAGIVRVDDQGRLTELSAPGQVGELALR
PGWPSMFRGYLHDEQRYRHCFRDNWYLSGDLAWRDEDGYYWFVGRSKELIKSSGHLIGPF
EVESVLLEHPAVAEAGVIGIPDVVAGEVVKAFVALKPGYEAGEDVLKSLMAHARKRLGPA
VAPREIAIKDNLPKTRSGKIMRRLLRARELGLPPGDISTLESDEGNGYEHSRRS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgaaatcatcaccaagacaccggagccgtccggcctcaggcccaatctgccg
gactaccggcaaggctgtcggcagtttgactggcagcaggccagagccaggctcaagggt
cgtgacggtgacatcaacatcgcctttgaggcactggactgccatgtgctggacgggcag
ggcgagcagaccgcgcttgtctggctgagcaaacagggggagcggcgcaccttcagctac
cgtgaattgcaggggctcagcaaccgctttgccagcctgctggccggcctgggcgtcgtc
aagggagaaaccgtgttcagcctgtgcggacgcacgccccagctgtatgccgccttgctg
ggcagcctgaaagccggcgccgtgttttgcccgctgttctccgcctttggccccgagccc
attcgttcccgtatggagattggcaatgccagggtattgatcagcagcgcccgtctttat
caaaagaaagtggcgccctggcgcagcgagctgccttatcttcagcatgtgttgctctac
gactgccacggcgactgccccgccggctgcctggatctggactccgctctggcgggggcc
gccgaaaccttttacatctgcccgacgcaacctgaagatccggccctgctgcactttacc
agcggcaccaccggcctgcccaagggcgccctgcatgtgcatgaggcggtggtgcatcac
agttattccgcctggtgcgcgctggatctgcatcccggcgacatttactggtgcacggcg
gatccgggctgggttaccggcaccagttatggcgtgattgcccccttgtgcaaccgagtc
accctggtcgtggacgaggcggagttcgatcccgagcgctggtaccggatcctggccgac
gaaaaggtcaatgtctggtatacggcccccaccgccattcgcatgctgatgaaagccggt
gacgagctgccggctcggtatgatctgggggcactgcgttttctggccagcgtcggcgag
ccgctcaatcccgaggcggtggtctgggggaagcggctatttggcatgccttttcacgac
aactggtggcagaccgaaaccggcggcatcatgctggccaattttgcatccgagccggtg
aagccgggttccatggggcagccgctgccgggcatcacggcgggcatagtccgggtggat
gaccaggggcggctcaccgagctgagcgctcccggccaagtgggcgagctggcgctgagg
ccgggctggccgtccatgttcaggggctatctgcatgatgagcaacgttaccgccactgc
ttcagggacaactggtatctgagcggcgatctggcctggcgggatgaagacggttattac
tggtttgtggggcgcagcaaggagctgatcaagtcttccggccatctgatcggtcccttt
gaggtggaaagcgtgctgctcgagcacccggcggtggcggaagccggggtcattggtatt
cccgatgtggtcgccggggaagtggtgaaggcctttgtggcgctcaaacccggttatgag
gccggtgaggacgtgctgaaaagcctgatggcccatgccagaaagcgcctgggcccggcg
gtggcgccccgggagatcgccatcaaggacaatctgcccaagacccgtagcggcaagatc
atgcgccgcctgctgcgggcccgcgagctgggcttgccaccgggcgatatttccaccctg
gaaagcgatgagggcaacggttatgaacactcacgccgaagctga

DBGET integrated database retrieval system