KEGG   Oceanimonas sp. GK1: GU3_12585Help
Entry
GU3_12585         CDS       T01667                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
oce  Oceanimonas sp. GK1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GU3_12585
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GU3_12585
Enzymes [BR:oce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GU3_12585
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     GU3_12585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2736809..2738197
Genome map
AA seq 462 aa AA seqDB search
MLNTVLGKIVADKKIWVEARKQSQPLASFEAALTPSDRPFAEALAAGKPAFILECKKASP
SKGLIREVFDLDAIAGVYGRYASAISVLTEEKYFQGRMEFVTRVREQVTQPVICKDFIVD
PYQIKLARHYQADAILLMLSVLDDEQYAELAKVAESLNMGVLTEVIDEEEVARALKLGAR
VIGINNRDLRDLSIDLDRTKRLAALIPEDRIVISESGIYHHGQTKALSAHADGFLVGSSL
MAEDHLELAVRRLILGDNKVCGLTRAEDAAAAFEAGAVYGGLIFVEKSPRCVSLDQARRV
MAGAPLHYVGVFQNQPADEIVATAQELNLAAVQLHGDEDDATIEQLKARLPGVAIWKAVA
VSDALPALPQHADRLLFDTKAGGQSGGTGQAFDWSLLANIDKASAMLAGGLTSDNAATAA
AVGCRGLDFNSGVESAPGQKDAGKLKAAFATLRHYGRRTNTQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatacggtgctcggcaaaattgttgccgacaagaaaatctgggtggaagcccgc
aaacaaagccagccgctggccagctttgaagccgcgctcaccccaagcgatcgtcccttt
gccgaggccctggccgccggcaagccggcctttattctggaatgcaaaaaggcctcgccc
tccaagggactgataagggaagtgtttgatctggatgccattgccggcgtctatggccgt
tacgcctcggccatttcggtgctgaccgaagaaaagtactttcagggccgcatggagttt
gtgacccgagtgcgcgaacaagtgacccagccggtgatctgcaaggacttcattgtcgat
ccttaccaaatcaagctggcccgccactaccaggccgatgccattctgctgatgctgtcg
gtgctggacgacgagcagtatgccgaactggccaaggtggccgaatccctcaatatgggc
gtgctcaccgaggtgatcgacgaagaggaagtggcccgggcgctgaaactgggtgccagg
gtgattggcatcaacaaccgggacctgcgggacctcagcatcgatctcgaccgcaccaaa
cggctggcggcactcattcccgaagaccgcatcgtgatctccgagtccggcatttaccat
cacggccagaccaaggcgctctcggcccatgccgacggctttctggtgggcagctcgctg
atggccgaagaccaccttgagcttgcggtgcgccggctgatcctcggcgacaacaaggtc
tgtggcctcactcgggccgaagacgccgccgccgcgtttgaagccggtgccgtttacggg
ggcctcatcttcgtggagaaaagcccccgctgcgtgagcctggaccaggcccgccgcgtg
atggccggcgccccgctgcactacgtgggcgtatttcagaatcagccagcagacgagata
gtggccaccgcacaagagctgaacctggcggcggtgcaactgcacggtgacgaagacgat
gccaccatcgagcaactcaaagcccggctgcccggcgtggccatctggaaagcggtggcg
gtaagcgatgcgctgcccgccctgccccagcacgccgatcggctgctgtttgataccaag
gctggcggccagagcggcggcaccggccaggcctttgactggagcctgctcgcaaacatc
gataaggccagtgccatgctggccggcgggctcacttccgacaacgccgccaccgccgcc
gccgttggctgccgcggcctggactttaactccggcgtggaaagcgctcccggccaaaaa
gatgccggcaaactcaaggcggcctttgccaccctcagacactacggacgcaggacaaac
acacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system