KEGG   Oceanimonas sp. GK1: GU3_12595Help
Entry
GU3_12595         CDS       T01667                                 

Definition
(GenBank) TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GU3_12595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GU3_12595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GU3_12595
Enzymes [BR:oce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GU3_12595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2739384..2740190
Genome map
AA seq 268 aa AA seqDB search
MSRYQRLFDRLKTADEGAFVPFVTLGDPTPEHSLKVIDALVAGGADALELGIPFSDPVAD
GPTIQAATLRARKAGTNSQICFDMLTQVREKYPELPIGLLVYANLVYAPGMDSFYGRAAK
AGVDSVLVADVPLEMAGPFKAAADRAGIESIYIAPPNGDEATLKAVAQTGSGYTYLLSRA
GVTGTETKAGAPVDTLLATLAKYDAPPSLLGFGISSPEQVRDAIAAGAAGAISGSAVVKI
IEQHLDQPQAMLDALTAFVKEMKAATRK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttaccagcgtttgtttgaccgtttgaaaaccgccgatgaaggcgcctttgtc
cccttcgtgaccctgggcgaccccacccccgaacactcgctgaaggtgattgacgccctg
gtggccggcggtgccgacgccctggagctgggcattcccttctccgatccggtggccgat
ggtcccaccattcaggccgccaccctgcgcgcccgaaaggccggcaccaactcgcaaatc
tgcttcgacatgctgactcaggtacgggaaaaataccccgagctgcccattggcctgctg
gtgtacgccaacctggtgtatgcgccgggaatggacagcttctatggccgtgccgccaag
gccggtgtggactcggtgctggtggccgacgtgccgctggaaatggccggacccttcaag
gccgccgccgaccgggccggcattgagagcatttacatcgccccgcccaacggcgacgag
gccaccctgaaagcggtggcacaaaccggctccggctacacctacctgctgagccgggcc
ggcgtgaccggcaccgaaaccaaggcaggcgccccggtcgacaccctgctggctaccctg
gccaaatacgatgcgccaccgtcgctgctcggctttggtatctccagccccgagcaggtg
cgcgacgccattgccgccggtgccgccggcgccatctccggatccgccgtggtcaagatc
atcgagcagcacctggaccagccccaggccatgctggatgccctcaccgcctttgtcaaa
gaaatgaaggccgcgacgcggaagtaa

DBGET integrated database retrieval system