KEGG   Oceanimonas sp. GK1: GU3_13065Help
Entry
GU3_13065         CDS       T01667                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
oce  Oceanimonas sp. GK1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GU3_13065
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GU3_13065
   00630 Glyoxylate and dicarboxylate metabolism
    GU3_13065
Enzymes [BR:oce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GU3_13065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2851320..2853497)
Genome map
AA seq 725 aa AA seqDB search
MTERTHLGTLQVATVLHDLVVNEIIPGTGVEPAAFWNGMEQIVNDLAPKNRALLEKRDAL
QQQIDEWHRANAGKPHDAVAYKQFLTDIGYLVPVVEDYQITTTNVDAELATLAGPQLVVP
VNNARYCLNAANARWGSLYDALYGSDAIPETDGAEKTKSLNPRRAEKVIVWGRNLLDQAA
PLTAGSHADATAYKVENGQLLITLENGDTTTLADADKFAGYKGDTAAPSAVLVRNNGLHI
ELQFDAANPVAQLDKAGIKDLVVEAALSTIMDCEDSVAAVDAEDKVGVYRNWLGLMKGTL
SQKVKKGDKEIIRTLNPDREYLNPQGEAFTLHGRSLLFVRNVGHLMTNEAVLDKDGNEVP
EGIIDGLVTCLIAIHDLKGNGKYRNSRTGSVYIVKPKMHGPEEVAFAVELFSRIENVLGL
AENTLKVGIMDEERRTSANLKSAIYEARDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGN
MRMQPWISAYENNNVDVGLAAGLQGKAQIGKGMWAIPDNMATMLETKIVHPLAGANTAWV
PSPTAAVLHATHYHQVNVKERQDELKSRKPAKLDDLLTIPLLTQADRDALTAEEIQNELD
NNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLRHGILTQEQVM
ESMKRMAAIVDQQNAGDPLYRNMAPDFDGIAFEAACALVFEGTTQPSGYTEPLLHAYRRK
LKAQG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgtactcacctcggcactttgcaagtcgctaccgttctacatgatctggta
gtaaatgaaatcattcccggtaccggcgttgagcctgccgcgttctggaatggcatggag
cagatcgtcaacgatctggcccccaagaaccgcgccctgctggaaaagcgcgatgccctg
cagcaacagattgatgaatggcaccgggccaacgccggcaagcctcacgatgccgttgcc
tacaagcagttcctgaccgacatcggctacctggtgccggtggtggaagactatcaaatc
accaccaccaatgttgatgccgagctggccaccctggccggtccgcagctggtggtaccg
gtgaacaacgcccgttactgcctgaacgccgccaacgcgcgctggggcagcctgtacgat
gcgctgtacggcagcgacgccattcccgagaccgatggcgccgaaaagaccaagtccctg
aacccgcgccgcgccgaaaaggtgatcgtctggggacgcaacctgctggatcaggccgct
ccgctgactgccggcagccatgccgatgccaccgcctataaagtggaaaacggccagctg
ctcatcaccctggaaaacggtgataccaccaccctggccgatgccgacaagttcgccggc
tacaagggtgataccgcggctcccagcgccgtgctggtacgcaacaacggtctgcacatt
gaattgcagttcgacgccgccaacccggttgcccagctcgacaaggccggcatcaaggat
ctggtggtggaagccgccctgtccaccatcatggactgcgaagactccgtggcggccgtg
gacgccgaagacaaggtcggtgtctaccgcaactggctgggcctgatgaagggtaccctg
agccagaaggtgaaaaagggcgacaaggaaatcatccgcaccctgaacccggatcgcgag
tacctgaacccccagggcgaagcctttaccctgcacggccgcagcctgctgttcgttcgt
aacgtgggtcacctgatgaccaacgaagcggtactggacaaggacggcaacgaggtgccg
gaaggcatcatcgacggtctggtgacctgcctcatcgccattcacgatctcaagggcaac
ggcaagtaccgcaactcccgtaccggcagcgtgtatatcgtcaagcccaagatgcacggc
ccggaagaagtggcctttgccgtcgagctgttcagccgcatcgaaaacgtgctgggcctg
gccgaaaacaccctgaaagtgggcatcatggacgaagagcgtcgcaccagcgccaacctg
aagtccgccatctacgaagcccgtgaccgtgtggtgttcatcaataccggtttcctggat
cggaccggtgacgaaatccacaccagcatggaagccggcgccgtggtgcgcaagggcaac
atgagaatgcaaccctggatcagcgcctacgaaaacaacaacgtggacgtgggtctggcc
gccggcctgcagggcaaggcacaaatcggcaagggcatgtgggccatccccgataacatg
gccaccatgctggaaaccaaaatcgtacaccccctggccggtgccaacaccgcctgggtg
ccgtcgccgaccgcggccgtactgcacgccacccattaccaccaggtgaacgtgaaagag
cgtcaggacgagctgaagtcgcgcaagccggccaagctggacgatctgctgaccattccg
ctgctgacccaggccgaccgtgatgccctgaccgcagaagagatccagaacgagctggac
aacaacgcccagggcattctgggttatgtggtccgctggattgaccagggggtgggctgt
tccaaggtgcccgacatcaacaacgtgggcctgatggaagaccgcgccaccctgcgcatc
tccgctcagcacatcgccaactggctgcgccacggcattctgacccaggagcaggtgatg
gagtccatgaagcgcatggccgccatcgtggaccagcaaaacgccggtgacccgctgtac
cgcaacatggcgcccgactttgacggcatcgcctttgaagcggcctgtgccctggtgttt
gaaggtaccacccagcccagcggttacaccgagccgctgctgcacgcctaccgtcgcaag
ctgaaagcccagggctaa

DBGET integrated database retrieval system