KEGG   Oceanimonas sp. GK1: GU3_13265Help
Entry
GU3_13265         CDS       T01667                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oce  Oceanimonas sp. GK1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GU3_13265
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GU3_13265
Enzymes [BR:oce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GU3_13265
Two-component system [BR:oce02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GU3_13265
Bacterial motility proteins [BR:oce02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GU3_13265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2890559..2891698)
Genome map
AA seq 379 aa AA seqDB search
MTIRVLVVDDSSFFRRRVSEILAQDPQLEVIDTAANGREAIDKVKTLRPDVITMDIEMPV
MDGITAVREIMKATPTPVLMFSSLTHEGARATLEALEAGALDFLPKRFEDIARSKEEAIQ
QLQQRVRAIARRRPGALSPRPSSVLSSLSSRPAPARSPAPALSRFNRTEPAPAVPAATER
RSLPRRSGKSYQLLAIGTSTGGPVALQAVLTKLPANFPHPIVLIQHMPGTFTTAFAARLD
GLCQIRVKEAEDGDVLRPGHAYLAPGGRQMMFEGRPGAARLRILDGNDKVNYKPCVDITF
ASAAKVYGGKVLAVVLTGMGADGRDGARLLKEQGASVWAQDEETCVVYGMPQAVARAGIA
TESLPLPLIGDAIVNEMAG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgactattcgggttttggtggtcgacgactccagctttttccgccggcgggtcagcgag
atcctggcgcaggatccccagcttgaggtgatcgacaccgccgccaacggcagagaagcc
atcgacaaggtgaaaacgctgcgaccggacgtgatcaccatggatattgaaatgccggtg
atggacggcattaccgcggtgcgcgagatcatgaaggccacgcccacgccggtgctgatg
ttttcttccctgacccacgaaggggcccgggccaccctggaggcgctggaggccggcgcc
ctggactttctgcccaagcgctttgaagacattgcccgcagcaaggaagaagccattcag
caactgcagcagcgggtaagggccattgcccgccgtcgtccgggggcgctgagcccgcgt
ccgtcatcggtgctgtcgtcgttgtcgtcccggcccgccccggcgcgcagcccggccccg
gccctgagccggttcaaccggaccgagccggcgccggcggtgcccgccgcgaccgagcgg
cgcagcctgccccggcgcagcggcaagagctaccagctgctggccatcggcacctccacc
ggggggccggtggcgctgcaggcggtgctcaccaaactgccggccaactttccccatccc
atcgtgctgatccagcacatgccgggcacctttaccaccgcctttgccgcccgccttgac
ggcctgtgccagattcgggtgaaggaagcggaagacggtgacgtgctgcgtccgggccac
gcctacctggcgcccggcggccggcagatgatgtttgaaggccgtcccggggcggctcgg
ctgcgcattctcgacggcaatgacaaggtcaactacaagccctgtgtcgacattaccttt
gcctccgccgccaaggtgtatggcggcaaggtgctggcggtggtgctcaccggcatgggg
gccgatggccgcgatggcgcccgcctgctcaaggagcagggcgccagtgtctgggcccag
gatgaggaaacctgcgtggtctacggcatgccccaggcggtggcccgagccggcattgcc
accgagtcgctgccgttgccgctgatcggcgacgccatcgtcaacgaaatggcgggctga

DBGET integrated database retrieval system