KEGG   Oceanimonas sp. GK1: GU3_13265Help
Entry
GU3_13265         CDS       T01667                                 

Definition
(GenBank) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce02020  Two-component system
oce02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GU3_13265
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GU3_13265
Enzymes [BR:oce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GU3_13265
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GU3_13265
Two-component system [BR:oce02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GU3_13265
Bacterial motility proteins [BR:oce02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GU3_13265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AEY02406
UniProt: H2FXS4
Position
complement(2890559..2891698)
Genome map
AA seq 379 aa AA seqDB search
MTIRVLVVDDSSFFRRRVSEILAQDPQLEVIDTAANGREAIDKVKTLRPDVITMDIEMPV
MDGITAVREIMKATPTPVLMFSSLTHEGARATLEALEAGALDFLPKRFEDIARSKEEAIQ
QLQQRVRAIARRRPGALSPRPSSVLSSLSSRPAPARSPAPALSRFNRTEPAPAVPAATER
RSLPRRSGKSYQLLAIGTSTGGPVALQAVLTKLPANFPHPIVLIQHMPGTFTTAFAARLD
GLCQIRVKEAEDGDVLRPGHAYLAPGGRQMMFEGRPGAARLRILDGNDKVNYKPCVDITF
ASAAKVYGGKVLAVVLTGMGADGRDGARLLKEQGASVWAQDEETCVVYGMPQAVARAGIA
TESLPLPLIGDAIVNEMAG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgactattcgggttttggtggtcgacgactccagctttttccgccggcgggtcagcgag
atcctggcgcaggatccccagcttgaggtgatcgacaccgccgccaacggcagagaagcc
atcgacaaggtgaaaacgctgcgaccggacgtgatcaccatggatattgaaatgccggtg
atggacggcattaccgcggtgcgcgagatcatgaaggccacgcccacgccggtgctgatg
ttttcttccctgacccacgaaggggcccgggccaccctggaggcgctggaggccggcgcc
ctggactttctgcccaagcgctttgaagacattgcccgcagcaaggaagaagccattcag
caactgcagcagcgggtaagggccattgcccgccgtcgtccgggggcgctgagcccgcgt
ccgtcatcggtgctgtcgtcgttgtcgtcccggcccgccccggcgcgcagcccggccccg
gccctgagccggttcaaccggaccgagccggcgccggcggtgcccgccgcgaccgagcgg
cgcagcctgccccggcgcagcggcaagagctaccagctgctggccatcggcacctccacc
ggggggccggtggcgctgcaggcggtgctcaccaaactgccggccaactttccccatccc
atcgtgctgatccagcacatgccgggcacctttaccaccgcctttgccgcccgccttgac
ggcctgtgccagattcgggtgaaggaagcggaagacggtgacgtgctgcgtccgggccac
gcctacctggcgcccggcggccggcagatgatgtttgaaggccgtcccggggcggctcgg
ctgcgcattctcgacggcaatgacaaggtcaactacaagccctgtgtcgacattaccttt
gcctccgccgccaaggtgtatggcggcaaggtgctggcggtggtgctcaccggcatgggg
gccgatggccgcgatggcgcccgcctgctcaaggagcagggcgccagtgtctgggcccag
gatgaggaaacctgcgtggtctacggcatgccccaggcggtggcccgagccggcattgcc
accgagtcgctgccgttgccgctgatcggcgacgccatcgtcaacgaaatggcgggctga

DBGET integrated database retrieval system