KEGG   Oceanimonas sp. GK1: GU3_14400Help
Entry
GU3_14400         CDS       T01667                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
oce  Oceanimonas sp. GK1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:oce00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3131443..3132441)
Genome map
AA seq 332 aa AA seqDB search
MSEDGRIIDGASPRAITTSEGQSYALFFALVANDKPAFAQLLRWTENNLAGGDLVARLPA
WLWGESDEGDWRVLDPNNAADSDLWIAYSLLEAGRLWHQPEYTRRGRALLWRSAAESLHW
LPGLGLTLLPGKQGFEKAEGWKLNPSYLPLPLLARFAEEARVWKDVYESSLHLLKVSAPQ
GLAPDWLWWQRSGAPELTALETGSYDAIRVYLWAGLAAPGSPGRSELLVHFRPMLAHVRQ
TGAPPERTNTVTGAFNGTGPVGFSAALLPMLAALPDQASELKRQLQRLHEQPPTADAYYD
RSLLLFGMGNYEQRYRFDQQGRLMLAKEGTCN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggatggccgcattattgatggggcttcgccccgggccattacaacgtcagag
gggcagagttatgccttgttctttgccctggtggccaatgataagccagcctttgcgcaa
ctgttgcgctggaccgagaacaacctggccggcggcgatctggttgcacgcctgccggcc
tggctgtggggcgaaagtgacgagggcgactggcgcgtactggatcccaacaacgccgct
gattcggatctatggattgcctacagcctgctggaagcgggccggctctggcaccaaccc
gaatatactcggcgggggcgggcgctgttatggcgctcggcagcggaaagcctgcattgg
ctgcccgggctggggttaaccctgctgccaggcaaacaggggtttgaaaaagctgaaggc
tggaagctgaacccgtcttacctgcccttgccgttgctggcccgctttgccgaagaggcc
cgggtctggaaggatgtgtatgaatccagtctgcatttgctgaaggtctcggcgccccaa
gggctggcacccgactggctgtggtggcaacgcagcggagcgcctgaactgacagcgctg
gaaaccggcagctacgacgccatacgcgtgtacttatgggccgggctggcggcgccgggt
tcgccgggccggagtgagctgctggttcattttcggcccatgctggcacacgtccggcaa
accggcgcgccgcctgagcggacaaatactgtcaccggtgcgtttaacggcaccgggccc
gtcgggttctccgccgccctactgcccatgctggcggccttgcctgatcaggcgtccgag
ctcaagcgccagttgcagcggctgcacgagcagccaccgacggcggatgcctactatgat
cgctccctgctgctgtttggcatggggaactacgagcaacgctatcgctttgatcaacaa
ggcaggttgatgttagccaaggagggtacatgcaactag

DBGET integrated database retrieval system