KEGG   Oceanimonas sp. GK1: GU3_14485Help
Entry
GU3_14485         CDS       T01667                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
oce  Oceanimonas sp. GK1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GU3_14485
Enzymes [BR:oce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GU3_14485
    3.5.1.-  
     GU3_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3149245..3149892
Genome map
AA seq 215 aa AA seqDB search
MKLPAKHRVASLDVDAQYTFTPVCPDELPVAGGDTLAAELNRQAAFAGVRLGSKDAHSPS
AHWVASDDKPAFNKISGDNVDIRWPLHAVPGTKGFELLDGLPHPADYDFFVWKGVELDMH
PYGACYHDLSERLSTGVIEYLRGNHIDTVLVGGLATDYCVFHTVKQLLAAGFNVIVNRAA
TRGVADDSSRHAIAEMIQLGAHFVHDAGELEQADD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcccgccaaacacagggtagccagtctcgacgtggatgcccagtataccttt
actcccgtctgccccgatgaactgccggtggccggtggcgatacccttgccgccgaactc
aaccgccaggccgcctttgccggtgttcgcctgggatccaaggatgcccattcaccgtcg
gcccactgggtcgccagcgacgacaagcccgccttcaacaaaatatcgggcgacaacgtc
gatattcgctggcccctgcatgcagtgcccggcaccaaaggctttgaactgctcgacggc
ctgccccaccccgccgactacgactttttcgtgtggaagggggtcgagctcgacatgcac
ccctacggcgcctgctatcacgacttgagcgagcgcctgagtaccggggtcattgagtac
ctgcgcggcaaccacatcgacaccgtgctggtaggggggctggccaccgactactgcgtg
tttcacacggtcaagcagctgctggccgccggatttaacgtcatcgtcaaccgcgccgcc
acccggggcgtggccgacgacagcagccgccatgccattgccgagatgatccagctgggt
gcccacttcgtgcatgatgccggcgagctggagcaggccgatgactga

DBGET integrated database retrieval system