KEGG   Oceanimonas sp. GK1: GU3_14755Help
Entry
GU3_14755         CDS       T01667                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
oce  Oceanimonas sp. GK1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_14755
Enzymes [BR:oce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     GU3_14755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3217747..3218517
Genome map
AA seq 256 aa AA seqDB search
MKIAHPNCHALISTQGAQLLHWQPAITEQPVLWHSDKAFWKPGLPVRGGIPLCWPWFGKH
QQPSHGFARLLEWTLTEQRQDADATYLAFELTDNEYTKHLWPYAFLARVHMILGKQCDIQ
LEVDCNVNTTAALHTYLRTGNVQGTTVTGLGEQYQDALQGLKPCSAGPALQLDGPVDRIY
TTPPNTTVLKDTSFNREIKLDHRHHSDLVVWNPWHEGEHHLADVNAGQFQEFFCIETAAI
NRPCTNRLGVSISLPS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgcacacccaaactgccatgcattaatttctactcaaggtgcacaattacta
cactggcagcctgccataactgaacaacccgtactttggcattcagataaggctttctgg
aagcccggcttacccgttcggggtggaatccctctgtgctggccctggtttggcaaacac
caacagcccagccatggctttgcccgcctgctcgagtggacactgacagagcagcggcaa
gatgctgacgctacttaccttgcttttgaactaaccgataatgaatacaccaaacacctt
tggccatacgcctttttggccagggttcatatgatattgggcaagcagtgtgatattcag
ctggaagtcgattgcaacgttaacaccactgccgccctgcatacctatctcagaacaggc
aatgtgcaaggcacaaccgtaaccgggctgggtgagcaatatcaggatgctctgcaaggc
ctcaagccatgttcagctggccctgcattacaactggacgggccggtagatcgcatctat
accactcctccaaataccaccgttttaaaggatacaagcttcaaccgggagataaagcta
gatcaccgccatcattccgatctggtggtatggaacccctggcacgaaggtgaacaccat
ttagctgatgtcaatgctgggcagtttcaggaatttttctgtattgaaacggcagccatt
aaccgcccttgtacaaaccgccttggtgttagcatcagtcttccatcttaa

DBGET integrated database retrieval system