KEGG   Oceanimonas sp. GK1: GU3_14755Help
Entry
GU3_14755         CDS       T01667                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00010  Glycolysis / Gluconeogenesis
oce01100  Metabolic pathways
oce01110  Biosynthesis of secondary metabolites
oce01120  Microbial metabolism in diverse environments
oce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GU3_14755
Enzymes [BR:oce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     GU3_14755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEY02704
UniProt: H2FUF6
Position
3217747..3218517
Genome map
AA seq 256 aa AA seqDB search
MKIAHPNCHALISTQGAQLLHWQPAITEQPVLWHSDKAFWKPGLPVRGGIPLCWPWFGKH
QQPSHGFARLLEWTLTEQRQDADATYLAFELTDNEYTKHLWPYAFLARVHMILGKQCDIQ
LEVDCNVNTTAALHTYLRTGNVQGTTVTGLGEQYQDALQGLKPCSAGPALQLDGPVDRIY
TTPPNTTVLKDTSFNREIKLDHRHHSDLVVWNPWHEGEHHLADVNAGQFQEFFCIETAAI
NRPCTNRLGVSISLPS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgcacacccaaactgccatgcattaatttctactcaaggtgcacaattacta
cactggcagcctgccataactgaacaacccgtactttggcattcagataaggctttctgg
aagcccggcttacccgttcggggtggaatccctctgtgctggccctggtttggcaaacac
caacagcccagccatggctttgcccgcctgctcgagtggacactgacagagcagcggcaa
gatgctgacgctacttaccttgcttttgaactaaccgataatgaatacaccaaacacctt
tggccatacgcctttttggccagggttcatatgatattgggcaagcagtgtgatattcag
ctggaagtcgattgcaacgttaacaccactgccgccctgcatacctatctcagaacaggc
aatgtgcaaggcacaaccgtaaccgggctgggtgagcaatatcaggatgctctgcaaggc
ctcaagccatgttcagctggccctgcattacaactggacgggccggtagatcgcatctat
accactcctccaaataccaccgttttaaaggatacaagcttcaaccgggagataaagcta
gatcaccgccatcattccgatctggtggtatggaacccctggcacgaaggtgaacaccat
ttagctgatgtcaatgctgggcagtttcaggaatttttctgtattgaaacggcagccatt
aaccgcccttgtacaaaccgccttggtgttagcatcagtcttccatcttaa

DBGET integrated database retrieval system