KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c00570Help
Entry
OCA5_c00570       CDS       T01617                                 

Gene name
trpB
Definition
tryptophan synthase beta chain TrpB (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCA5_c00570 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCA5_c00570 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCA5_c00570 (trpB)
Enzymes [BR:ocg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCA5_c00570 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66860..68077)
Genome map
AA seq 405 aa AA seqDB search
MSLPKPNSFRAGPDERGHFGTFGGRFVAETLMPLILDLEKAYAAAKADPSFQKEMNGYLK
DYVGRPSPLYFAERLTEHLGGAKIYLKREELNHTGSHKVNNVLGQIMVARRMGKKRIIAE
TGAGQHGVATATLCARFGLECIVYMGAVDVARQEPNVIRMEMLGAKVVPVQSGTRTLKDA
MNDALRDWVTNVATTFYCIGTVAGPHPYPAMVRDFQSVIGHETREQMMAAEGRLPDSLVA
CIGGGSNAMGLFHPFLDEPAVEIFGVEAAGHGLTNLHAASLAGGRPGVLHGNRTYLLMNE
DGQIQDAHSISAGLDYPGIGPEHAWLHETGRVTYLSATDEEALAAFQLLSRLEGIIPALE
SAHAIAKLSQLAPKRPRDHLMVVNLSGRGDKDVPQVGDILRGRKS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttccaaaacccaattccttccgcgcaggccctgatgagcgtggtcacttcggc
accttcggcggccgcttcgtcgccgaaacactgatgccgttgatcctcgatctcgagaag
gcctatgccgcggcgaaggccgatccgtcatttcagaaggaaatgaacggctatctcaag
gattatgtcggccgtccgtcgcccctgtatttcgccgaacgcctcaccgagcatctcggc
ggtgcgaagatttatctcaagcgcgaagagctgaaccacaccggctcgcacaaggtgaac
aacgtgctcggccagatcatggtcgcgcgccgcatgggcaagaagcgcatcatcgcagag
accggcgcggggcagcatggcgttgccaccgcgacgctgtgcgcgcgcttcgggctcgaa
tgtatcgtgtacatgggtgcggtcgatgttgcgcggcaagagccgaacgtcatccgtatg
gagatgctgggcgccaaggtggtgccggtgcagtccggcacgcgcacgctgaaagatgcg
atgaacgatgcgctgcgcgattgggtgacgaacgtggcgaccacgttctattgcatcggc
acggtggcgggcccgcatccctatcctgcgatggtgcgcgacttccagtcggtgatcggc
catgagacgcgcgagcagatgatggcggcggaaggccgcctgccggattcgctggtcgcc
tgcatcggcggcggctccaatgcgatggggctgtttcatccgttcctcgatgagcctgcc
gtcgagattttcggcgtcgaggccgcgggccatgggctgacgaatttgcacgctgcctcg
ctcgcgggcggtcgccccggcgtgctgcacggcaatcgcacgtatctcctgatgaacgag
gacggccagattcaggacgcgcattcgatttcggcgggcctcgattatcccggcatcgga
ccggagcatgcctggctgcacgagaccggccgcgtgacgtatctgtccgcgaccgacgag
gaagcgctcgccgcgttccagttgctgtcgcggctcgaaggcatcattccggcattggag
tcggcgcatgcgatcgcgaagctgtcgcagctcgcgccgaagcggccgcgcgatcacctg
atggtcgtcaatctctccggccgtggcgacaaggacgtgccgcaggtcggcgatattctg
cgggggcgcaagtcatga

DBGET integrated database retrieval system