KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c01950Help
Entry
OCA5_c01950       CDS       T01617                                 

Gene name
acsA
Definition
(GenBank) acetate-coenzyme A ligase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00010  Glycolysis / Gluconeogenesis
ocg00620  Pyruvate metabolism
ocg00640  Propanoate metabolism
ocg00680  Methane metabolism
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
ocg01130  Biosynthesis of antibiotics
ocg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA5_c01950 (acsA)
   00620 Pyruvate metabolism
    OCA5_c01950 (acsA)
   00640 Propanoate metabolism
    OCA5_c01950 (acsA)
  Energy metabolism
   00680 Methane metabolism
    OCA5_c01950 (acsA)
Enzymes [BR:ocg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OCA5_c01950 (acsA)
Lipid biosynthesis proteins [BR:ocg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OCA5_c01950 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEI04926
UniProt: B6JAF2
Position
complement(212084..214039)
Genome map
AA seq 651 aa AA seqDB search
MSDAIYKVTPEWAKRAYVDEAKYNDMYARSIKDPTGFWKEAASRVDWIKPFTKVDNACFD
LGKVSIKWFEDGVLNAAYNCIDRHLEKRGDQTAIIWEGDDPSESRHITYRELHAEVCKMA
NVLRARNVKKGDRVTIYMPMIPEAAYAILACARIGAIHSVVFGGFSPDSIAGRLRDCKSR
VVITSDEGLRGGRVIAMKANVDAAVEKVNGEVDTVIVVKRTGGNITMNPKRDIWYHDAAA
NAGTDCPCEPMNAEDPLFILYTSGSTGQPKGVLHTTAGYLIFVAMTHQYVFDYHDGDIYW
CTADVGWVTGHSYILYGPLCNGATTMMFEGVPNYPDNSRFWNVIDKHKVNIFYTAPTAIR
ALMQAGDQPVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGDGRCPVVDTWWQTETGGIM
ISALPGAIAQKPGSATRPFFGIVPEIVDGEGNVLEGECSGNLCIARSWPGQVRTVYGDHD
RFEKTYFSTYKGRYFSGDGCRRDADGYYWITGRVDDVINVSGHRLGTAEVESSLVAHESV
SEAAVVGYPHDIKGQGIYAYVTLMDGVEPSETLRKDLIAWVRKDIGPIAQPDLIQFAPGL
PKTRSGKIMRRILRKIAEDEPTKLGDTTTLADPGVVTDLVNNRQNKRAVHA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaatttacaaagtgacgcccgaatgggcgaagcgcgcctatgtcgatgaa
gccaaatacaacgacatgtacgcgcgctcgatcaaggacccgaccgggttctggaaagag
gccgccagccgggtggactggatcaagccgttcaccaaggtcgacaatgcctgcttcgat
ctcggcaaggtttccatcaagtggttcgaggacggcgtcctcaacgccgcctacaactgc
atcgaccgccatctcgagaagcgcggcgaccagaccgcgatcatctgggaaggcgacgat
ccgtcagagtcccgccacatcacctatcgcgaactgcacgccgaagtctgcaagatggcg
aacgtgctgcgggcacgcaacgtcaagaagggcgatcgcgtcaccatctacatgccgatg
atcccggaagcggcttacgcgatcctcgcctgcgcgcgcatcggcgcgatccattccgtg
gtattcggcggcttctcgcctgattccatcgccggccgtctgcgcgattgcaaatcgcgc
gtcgtcatcacctcggatgaaggcctgcgcggcggccgcgtcattgcgatgaaggcgaac
gtcgatgcggcggtcgagaaggtgaacggcgaagtcgacaccgtgatcgtggtgaagcgc
accggcggcaacatcacgatgaacccgaagcgcgacatctggtatcacgacgctgcggcg
aacgccggcaccgactgcccctgcgagccgatgaacgccgaagatccgctgttcatcctc
tacacttcaggctcgaccggtcagcccaagggcgtgctgcacaccaccgcgggctatctc
atcttcgtggcgatgacgcatcaatacgtcttcgactaccacgacggcgacatctactgg
tgcaccgccgacgtgggctgggtcaccggccacagctacattctgtacgggccgctttgc
aacggcgcgaccacgatgatgttcgaaggcgtgccgaactatcccgacaattcgcggttc
tggaacgtcatcgacaagcacaaggtcaacatcttctatactgcgccgaccgcgatccgc
gcgctgatgcaggcgggcgaccagccggtgaagaagacctcgcgtgcctcgctgcgcctg
ctcggctcggtcggcgagccgatcaacccggaggcatgggagtggtatcaccgcgtcgtc
ggcgatggccgttgcccggtggtcgacacctggtggcagaccgagaccggcggcatcatg
atctccgcgctgcccggcgcgatcgcgcagaagcccggctcggcaacgcgaccattcttc
ggcatcgtgccggagatcgtcgacggcgagggcaacgtgctcgagggcgaatgcagcggc
aacctctgcatcgcgcgctcgtggcccggccaggtccgcaccgtttacggcgatcatgat
cgcttcgagaaaacctacttctcgacttacaagggccggtacttctccggcgatggatgc
cgccgcgatgccgacggctattactggatcaccggacgcgtcgacgacgtcatcaacgtc
tccggccaccgcctcggcaccgccgaagtcgagagctcgctggtcgcgcatgaaagcgtg
tcggaagccgccgtggtcggctacccgcacgacatcaagggccagggcatctacgcctat
gtcactttgatggacggcgtcgagccgagcgagacgctccgcaaggacctgatcgcctgg
gtgcgcaaggacatcggcccgatcgcccagcccgatctgatccagttcgcgccgggcctg
cccaagacccgttcgggcaagatcatgcgccgcatcctgcgcaaaatcgccgaggacgag
ccgaccaagctcggcgacacgacgacgctcgctgatcccggcgtcgtcaccgacctcgtc
aacaaccgccagaacaagcgggcggttcacgcctga

DBGET integrated database retrieval system