KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c01950Help
Entry
OCA5_c01950       CDS       T01617                                 

Gene name
acsA
Definition
acetate-coenzyme A ligase AcsA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ocg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ocg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ocg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ocg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ocg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212084..214039)
Genome map
AA seq 651 aa AA seqDB search
MSDAIYKVTPEWAKRAYVDEAKYNDMYARSIKDPTGFWKEAASRVDWIKPFTKVDNACFD
LGKVSIKWFEDGVLNAAYNCIDRHLEKRGDQTAIIWEGDDPSESRHITYRELHAEVCKMA
NVLRARNVKKGDRVTIYMPMIPEAAYAILACARIGAIHSVVFGGFSPDSIAGRLRDCKSR
VVITSDEGLRGGRVIAMKANVDAAVEKVNGEVDTVIVVKRTGGNITMNPKRDIWYHDAAA
NAGTDCPCEPMNAEDPLFILYTSGSTGQPKGVLHTTAGYLIFVAMTHQYVFDYHDGDIYW
CTADVGWVTGHSYILYGPLCNGATTMMFEGVPNYPDNSRFWNVIDKHKVNIFYTAPTAIR
ALMQAGDQPVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGDGRCPVVDTWWQTETGGIM
ISALPGAIAQKPGSATRPFFGIVPEIVDGEGNVLEGECSGNLCIARSWPGQVRTVYGDHD
RFEKTYFSTYKGRYFSGDGCRRDADGYYWITGRVDDVINVSGHRLGTAEVESSLVAHESV
SEAAVVGYPHDIKGQGIYAYVTLMDGVEPSETLRKDLIAWVRKDIGPIAQPDLIQFAPGL
PKTRSGKIMRRILRKIAEDEPTKLGDTTTLADPGVVTDLVNNRQNKRAVHA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcaatttacaaagtgacgcccgaatgggcgaagcgcgcctatgtcgatgaa
gccaaatacaacgacatgtacgcgcgctcgatcaaggacccgaccgggttctggaaagag
gccgccagccgggtggactggatcaagccgttcaccaaggtcgacaatgcctgcttcgat
ctcggcaaggtttccatcaagtggttcgaggacggcgtcctcaacgccgcctacaactgc
atcgaccgccatctcgagaagcgcggcgaccagaccgcgatcatctgggaaggcgacgat
ccgtcagagtcccgccacatcacctatcgcgaactgcacgccgaagtctgcaagatggcg
aacgtgctgcgggcacgcaacgtcaagaagggcgatcgcgtcaccatctacatgccgatg
atcccggaagcggcttacgcgatcctcgcctgcgcgcgcatcggcgcgatccattccgtg
gtattcggcggcttctcgcctgattccatcgccggccgtctgcgcgattgcaaatcgcgc
gtcgtcatcacctcggatgaaggcctgcgcggcggccgcgtcattgcgatgaaggcgaac
gtcgatgcggcggtcgagaaggtgaacggcgaagtcgacaccgtgatcgtggtgaagcgc
accggcggcaacatcacgatgaacccgaagcgcgacatctggtatcacgacgctgcggcg
aacgccggcaccgactgcccctgcgagccgatgaacgccgaagatccgctgttcatcctc
tacacttcaggctcgaccggtcagcccaagggcgtgctgcacaccaccgcgggctatctc
atcttcgtggcgatgacgcatcaatacgtcttcgactaccacgacggcgacatctactgg
tgcaccgccgacgtgggctgggtcaccggccacagctacattctgtacgggccgctttgc
aacggcgcgaccacgatgatgttcgaaggcgtgccgaactatcccgacaattcgcggttc
tggaacgtcatcgacaagcacaaggtcaacatcttctatactgcgccgaccgcgatccgc
gcgctgatgcaggcgggcgaccagccggtgaagaagacctcgcgtgcctcgctgcgcctg
ctcggctcggtcggcgagccgatcaacccggaggcatgggagtggtatcaccgcgtcgtc
ggcgatggccgttgcccggtggtcgacacctggtggcagaccgagaccggcggcatcatg
atctccgcgctgcccggcgcgatcgcgcagaagcccggctcggcaacgcgaccattcttc
ggcatcgtgccggagatcgtcgacggcgagggcaacgtgctcgagggcgaatgcagcggc
aacctctgcatcgcgcgctcgtggcccggccaggtccgcaccgtttacggcgatcatgat
cgcttcgagaaaacctacttctcgacttacaagggccggtacttctccggcgatggatgc
cgccgcgatgccgacggctattactggatcaccggacgcgtcgacgacgtcatcaacgtc
tccggccaccgcctcggcaccgccgaagtcgagagctcgctggtcgcgcatgaaagcgtg
tcggaagccgccgtggtcggctacccgcacgacatcaagggccagggcatctacgcctat
gtcactttgatggacggcgtcgagccgagcgagacgctccgcaaggacctgatcgcctgg
gtgcgcaaggacatcggcccgatcgcccagcccgatctgatccagttcgcgccgggcctg
cccaagacccgttcgggcaagatcatgcgccgcatcctgcgcaaaatcgccgaggacgag
ccgaccaagctcggcgacacgacgacgctcgctgatcccggcgtcgtcaccgacctcgtc
aacaaccgccagaacaagcgggcggttcacgcctga

DBGET integrated database retrieval system