KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c01990Help
Entry
OCA5_c01990       CDS       T01617                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00860  Porphyrin and chlorophyll metabolism
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCA5_c01990
Enzymes [BR:ocg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OCA5_c01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF1357_C DUF3147
Motif
Other DBs
NCBI-ProteinID: AEI04930
UniProt: B6JAE8
Position
216941..217705
Genome map
AA seq 254 aa AA seqDB search
MSILVMRPFPDNEATAAALRDEGYSVLLSPALRFEPVPLREEPDALPYDAILATSANALR
GIEGKPILERLCETKLFAVGDATAQIARNAGFRDVESAAGDAVALIALVEARMRGKGRIC
YLAGADVSRDLGADLGAQGYSVTTLTTYRMIPLPHFSEAVEAAFAAGEVEAVLHYSRRSA
RAFVAAVQAAGLEISALALPQFCISNVVGTVLQEAGAARVRVAAAPDEPAMFEALQRAIA
PKRPSRPKTKSGKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcctggtgatgcggccttttcctgacaacgaggcgaccgcggccgcattgcgg
gatgagggatatagtgtgttgctgtcgccggcgctgcggtttgagccggtgccgctgcgc
gaagagcctgacgcacttccctacgatgcgattcttgcgaccagcgccaatgcgctacgc
ggcatcgagggaaaaccaatcctggagcgactgtgcgagacaaagctgttcgctgtcggc
gatgcgacggcgcaaatcgcgcggaacgcgggctttcgcgatgtcgagagcgcagcgggc
gatgcggtagcgctgatcgcgctggtcgaggcgcggatgcgtggcaagggccggatctgc
tatctcgcgggggccgatgtgagccgcgacctcggtgccgatctcggcgcacaaggctac
agcgtgaccacgctcacgacttaccgcatgattccgcttccacatttttccgaagcggtt
gaggcggcgtttgcggccggagaggtcgaggcagtgctgcattattcgcggcgcagcgcg
cgggcattcgtcgccgcggtgcaggcggcaggccttgagatttccgcgctggcgctgccg
cagttctgcatctcgaacgtggtcggcacggtgttgcaggaggccggcgccgcgcgggtg
cgggtcgcggcggcgcccgatgagcctgcgatgttcgaggcattgcagcgtgcgatcgcg
ccgaagcggccatcgcggcccaaaacgaaatctggtaagctgtag

DBGET integrated database retrieval system