KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c02630Help
Entry
OCA5_c02630       CDS       T01617                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCA5_c02630 (folE1)
Enzymes [BR:ocg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     OCA5_c02630 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277274..277906
Genome map
AA seq 210 aa AA seqDB search
MSNLSNVQVLERDRKAEEESARPDRAEVEAAVRTIIRWAGDDPKRDGLIETPSRVARAFE
EFFIGYSQNPTTILQKTFEEIDGYDEMITLRAVRFESHCEHHMAPIVGKAWVAYIPNGRV
VGISKLARVVEVYAKRLQIQEKMTAQIANTINEVLKPQGVAVLIKAQHHCMTTRGIHKPG
TDLVTSRMLGCFRDNATTRQEFLSMTTDPE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatctatcgaatgttcaggtgctcgagcgcgatcgcaaggcggaagaggagtcc
gcgcggccggatcgcgccgaggtggaggctgcggtccgcaccatcatccgctgggcgggc
gatgatccgaagcgtgatggcctcattgagacgccgagccgcgttgcgcgcgctttcgag
gagtttttcatcggctacagccagaatccgacgaccatcctgcagaagaccttcgaggaa
atcgacggctatgacgagatgatcacgttgcgtgccgtgcgcttcgaaagccattgcgag
caccacatggcgccgatcgtcggcaaggcctgggtggcctacattccgaacggacgcgtg
gtcggcatcagcaagctcgcgcgggtggtcgaggtctatgccaagcggctgcagatccag
gaaaagatgacggcacagatcgccaacaccatcaacgaggtgttgaagccgcagggtgtc
gccgtgctgatcaaggcgcagcatcattgcatgacgacgcgcggcatccacaagcccggc
accgatctcgtcaccagccgcatgctcggctgcttccgcgacaatgccacgacgcggcag
gaatttttgagcatgacgaccgaccccgaataa

DBGET integrated database retrieval system