KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c05810Help
Entry
OCA5_c05810       CDS       T01617                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase/phosphoglucomutase AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg00010  Glycolysis / Gluconeogenesis
ocg00030  Pentose phosphate pathway
ocg00051  Fructose and mannose metabolism
ocg00052  Galactose metabolism
ocg00230  Purine metabolism
ocg00500  Starch and sucrose metabolism
ocg00520  Amino sugar and nucleotide sugar metabolism
ocg00521  Streptomycin biosynthesis
ocg01100  Metabolic pathways
ocg01110  Biosynthesis of secondary metabolites
ocg01120  Microbial metabolism in diverse environments
ocg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCA5_c05810 (algC)
   00030 Pentose phosphate pathway
    OCA5_c05810 (algC)
   00051 Fructose and mannose metabolism
    OCA5_c05810 (algC)
   00052 Galactose metabolism
    OCA5_c05810 (algC)
   00500 Starch and sucrose metabolism
    OCA5_c05810 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    OCA5_c05810 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    OCA5_c05810 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OCA5_c05810 (algC)
Enzymes [BR:ocg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     OCA5_c05810 (algC)
    5.4.2.8  phosphomannomutase
     OCA5_c05810 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEI05305
UniProt: B6JJR7
Position
607278..608777
Genome map
AA seq 499 aa AA seqDB search
MFPKPKAELKPNTYAYESEPMVKATGFREYDARWLFGKEINLMGVQALGMGLGTMIGEMS
VKQEIVVGHDFRGYSASIKYALISGLLAAGCKVHDIGLAVTPMAYFAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLGAAFKLQPAGGYQFHENFPARYIADL
TKRKPFSRRIRAVVACGNGTAGAFAPQVLEKLGVDVIPLDTELDHTFPKYNPNPEDLEML
HAIRDAVLEHKADVGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSALHKNAQFVVD
VKSTGLFVTDPVLSRQGAQASYWKTGHSYMKRRTHELGALAGFEKSGHFFFNAPFGRGYD
DGLVSAIAICEMLDHAPGKKMSDLKNALPKTWSSPTMSPHCADEAKYGIVDKVVKHFETA
KAKGDKVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEKRMREMFE
AMDSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgaagccgaaagccgagctgaagcccaatacctacgcctatgaatccgagccg
atggtgaaggccaccggcttccgcgaatacgatgcgcgatggctgttcggcaaggaaatc
aacctgatgggcgttcaggcgctcggcatgggcctcggcaccatgatcggcgagatgagt
gtgaagcaggagatcgtggtcggccacgacttccgtggctactcggcctcgatcaaatac
gcgctgatctcgggcctgctcgcggccggctgcaaggtgcacgacatcggccttgcggtg
acgccgatggcctatttcgcgcagttcgatctcgacgtgccttgcgtggcgatggtcacg
gcctcgcataacgacaatggctggaccggcgtgaagatgggcgcgaaccggccgctcacc
ttcggtcccgacgagatgacgcggctgaaggagattgtgttgggcgcggccttcaagctg
cagccggccggtggctatcagtttcacgagaatttcccggcgcgctacatcgcggacctc
accaagcgcaagccgttctcgcgccgcatccgcgcggtggtcgcctgcggcaatggcacg
gcgggcgcattcgcaccgcaggtgctggaaaagctcggcgtcgacgttatcccgctcgat
accgaactcgaccacaccttcccgaaatacaatccgaatcctgaagaccttgagatgctg
catgcaatccgcgacgcggtgctcgaacacaaggccgatgtcggcctcggcttcgacggc
gatggcgatcgctgtggcgtggtcgacgacaccggtgaggaaatcttcgccgacaaggtc
ggcgtgatgctggcgcgcgatatgtcggcattgcacaagaacgcgcagttcgtcgtcgac
gtgaagtcgaccggattgttcgtcaccgatccggtgctctcgaggcagggcgctcaggcg
agttactggaagaccggccactcctacatgaagcgccgcacgcatgagcttggcgcgctg
gcgggcttcgagaagtccggccacttcttcttcaatgcgccgttcgggcgtggctatgac
gacggtctcgtctccgcgatcgcgatctgcgagatgctcgaccacgcgcccggcaagaag
atgtcggacctgaagaacgcgttgccgaaaacctggtcgtcgccgacgatgtcgccgcac
tgcgcggacgaagcgaagtacggcatcgtcgacaaggtggtgaagcatttcgagacggcg
aaggcgaagggcgacaaggtcgccggtcagccgatccgcgatctcgtcacagtgaacggc
gtgcgcgtcacctgcgaggacggaagctggggccttgtgcgcgcatcatcgaacaagccc
gaacttgtcgtggtggtggaaagcccggtctccgagaagcgcatgcgcgagatgttcgag
gcgatggacagcgttctgcgcacccatcccgaagtcggcgaatacaatcagaagatttaa

DBGET integrated database retrieval system