KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c05970Help
Entry
OCA5_c05970       CDS       T01617                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCA5_c05970 (recR)
DNA repair and recombination proteins [BR:ocg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OCA5_c05970 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623981..624586
Genome map
AA seq 201 aa AA seqDB search
MASTVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKREALMAPLASALQVAIERIQVC
HTCGNIDTQNPCTICSDPRRDPAIIVVVADVSDLWALERAHATQGRYHVLGATLSPLDGI
GPQDLTIDALVTRAQVPEVTEIILALNATVDGQTTAHYVTDMLQDANVKVTRLAHGVPVG
GELDYLDEGTLSAAMRQRTLF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaccgttgccggaccggagatcgagcggctgatccagttgctggcgcggctt
ccgggccttggcccgcgctcggcccgccgcgcggcgctgcatctcatcaagaagcgcgaa
gctctgatggcgccgctcgcctccgcattgcaagttgcgatcgagcgcattcaggtgtgc
cacacctgcggcaacatcgacacgcagaacccgtgcacgatctgcagcgacccgcggcgt
gatccggcgatcattgtggtggtggccgacgtctccgacctctgggcgctggagcgtgcg
catgcaacgcagggtcgctatcatgtgttgggtgcgacgctgtcgccgctcgacggcatc
ggcccgcaagacctcaccatcgatgcgctggtgacgcgcgcgcaggtgcccgaagtgacc
gagatcattctcgcgctcaatgccactgtcgatggccagaccacggcgcactacgtcacc
gacatgctgcaggatgccaacgtcaaggtgacgcggctcgcgcatggcgtgccggtcggc
ggcgaactcgattatctcgatgagggtacgctgtcggcggcgatgcggcagcggacgctg
ttctag

DBGET integrated database retrieval system