KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06440Help
Entry
OCA5_c06440       CDS       T01617                                 

Definition
protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677648..678565
Genome map
AA seq 305 aa AA seqDB search
MQEAKTRDGVSLFSPAELAVVRRAFGRQMLAVLGVENPAIAAAFAAVPREAFLGPPPWTA
VSPVIAHHVLPDRDPVVLYQDIVVALDPARGVNNGSPSLHAKLLEALGPKSGEHVVHIGA
GSGYYSAMLSELVGLSGRVTAVEFDPALADKARNNLSSYRNVTVVCGDGTRWPENEADGV
YVNFAVARPADRWIEGLASGGRLVFPLGVPGPQQPHLGGRHAEHGAALRIERRAEGYAAE
AITPAYFVWAEGNSDVAPDELARLRAAFEGGGLDRVRSLIWKRPAPPERCWFIGASWALG
CDETL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaggccaaaaccagagacggcgtctctctcttttcgccggctgagcttgccgtg
gtgcggcgcgcgtttggccgtcagatgctggcggtgctcggcgtcgagaaccccgccatc
gccgcagcctttgcggccgtgccgcgcgaggcgtttctcgggccgccgccatggacggcg
gtctcgccggttatcgcccatcatgtgctgccggaccgggacccggtggtgctctatcag
gatatcgtcgtggcgctcgatccggcgcgcggcgtcaacaacggcagcccgtcgctgcac
gccaagctcctcgaggcgctggggccgaagtccggcgagcatgtcgtccatatcggcgcc
ggtagcggctattacagcgcgatgctttccgaactggttggcctgtccggtcgcgtcact
gccgtcgagttcgacccggcgcttgcggacaaggccaggaacaatctctcgtcctatcgc
aacgtgacggtcgtctgcggcgacggcacgcgctggccggaaaatgaagccgacggcgtc
tatgtgaatttcgccgtggcacggccggccgaccgctggattgaagggctcgcctccggt
ggccggttggtgtttccgctcggcgtccccggtccgcagcagccgcatctgggcggtcgc
catgccgagcacggagccgcactgcggatcgagcggcgggccgagggctatgcggccgag
gcgatcacgccggcctatttcgtctgggccgaaggcaactctgatgtggcccccgatgaa
ctcgcgcgattgcgagcggcctttgagggcggcggtctcgaccgggtacgcagcctgatc
tggaagcgtcccgcgccgccggagcgttgctggttcatcggcgcgtcatgggcgctcggc
tgtgacgaaacgctgtga

DBGET integrated database retrieval system