KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06470Help
Entry
OCA5_c06470       CDS       T01617                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCA5_c06470
Enzymes [BR:ocg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     OCA5_c06470
Peptidases [BR:ocg01002]
 Cysteine Peptidases
  Family C44
   OCA5_c06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681674..683470
Genome map
AA seq 598 aa AA seqDB search
MSNDRGGSSGTLSEAILLPCRDGLISIEGIVQRVDGEIGAAALRRLVEIVERDGPAALAC
AEGDFVALVQARDAVHAFKSFTSQYQIYYREADGLVANRLFAFWDAAGEWNEDYFARHVL
IVPGYQFLSRETPIKNVVRVLPGELVSLRAQQIDRRQLVRRNYAYRFDPDQRREEVAEQV
LHLLRDGVKTRLAARPQARICVEISGGLDSSFIACLLGEQLSGGIRGVMFSQPRLPSHAI
SEQYARDVADRYGIELVVLPPEDLPVGVPDAPGYSDEPSDFFWFGDIFSRAVAGLAAPNS
YVFTGFGADQLFLRSPAFLPHLLRQKQYRAFRNTLPEASRLLSRGQVSIGWQCLLSQIPA
ELHRRLQHAWPFRGWNPWDVSDVNMERALTDDIAWLRCGKSLAAYSQERAVAEATLVGNG
ILCDDWGYFSAPRAVTQAHFSGKSLVDASPFCDLPLLDYVYDQISALLVHDFGARYKELL
RDAQKGVVPDNLRNRQNDTFVFNSFQMAYIDATKERLESLLDEVDAAWIDVKAARLALQQ
LSFGMASSSTRSVTALLGYLQWRRSFLDFCAQRKASADHENADDGFFQASRAGLRNLG
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaacgaccgcggcggttcgtcgggcacattgtcggaagcgatcctgttgccctgc
cgggatgggctgatctcgatcgagggcatcgtgcagcgcgtcgatggcgagatcggcgcg
gccgcgttgcggcgtcttgtcgagatcgtcgagcgcgacgggcctgcggcgctcgcctgc
gcagagggcgatttcgttgcgctggtgcaggcgcgtgatgccgtccatgcgttcaagagc
ttcacctcgcaataccagatctactaccgcgaagcggatgggctggtcgccaatcgtctg
ttcgcgttctgggatgcggcgggagagtggaacgaggattactttgcccgtcacgttctg
atcgtgccgggctatcagtttctctcgcgcgagacgccaatcaaaaatgtcgtccgggtg
ctgcccggcgagcttgtctcgcttcgcgcgcaacagatcgaccgcaggcaattggtgcgc
cggaattatgcctatcggttcgatcccgatcagcgccgcgaggaggtggcggagcaggtg
cttcatctgctgcgcgatggcgtcaagacgcggctcgccgcgcggccgcaggcccgcatc
tgtgtcgagatttccggcgggctcgattcgtccttcatcgcgtgcctgctcggcgaacaa
ctctccggcggcattcgcggcgtgatgttttcgcagccgcgattgccgtcgcatgcgatc
agcgagcaatacgcgcgcgacgttgcggatcgttacgggatcgagcttgtggtgctgccg
ccggaggacttgccggtcggcgtgcctgacgcgccgggctattccgacgagccgagcgat
ttcttctggttcggcgatattttctctcgcgcggtggcaggattagctgcgccgaattcc
tatgtcttcaccggcttcggtgcggatcaattgtttctgcgctcgccggcgtttctgccg
catctgttgcggcagaaacaatatcgtgccttccggaacacgctgccggaagcgagccgg
ctgctgtcgcgcggtcaggtcagcatcggctggcaatgcctgctgtcgcagatacccgcc
gaactgcaccggaggctgcagcacgcgtggccgttccggggctggaatccgtgggatgtc
tccgacgtcaacatggaacgcgctctgaccgacgacatcgcctggctgcgatgcgggaaa
agcctcgccgcctattcgcaggaaagagcagttgcggaagcgacactcgtcggcaacggc
atattgtgcgacgactggggatatttttccgcaccgcgcgccgtgacgcaggcgcatttc
agcggcaagtcgctggtcgatgcgtcgccgttctgcgatctgccgttgctcgattatgtt
tacgatcagatcagcgcgttgctggttcacgatttcggcgcgcgctacaaggagctgctg
cgcgatgcgcagaagggtgtcgtgccggacaatctgcgcaatcgccagaacgatacgttt
gtcttcaactcgttccagatggcttatatcgatgcgacgaaggagcggcttgaaagtctg
ctcgacgaggtcgatgccgcgtggatcgatgtcaaagccgcgcggctcgcgcttcagcaa
ttgtcgttcggcatggcctcgagctcgacgcgctcggtgacggcgctgctcggctatctg
cagtggcggcggtcgtttctcgatttctgcgcgcagcgaaaagcgagcgcggaccatgaa
aacgcggatgacgggttctttcaggccagcagggcagggttgcggaacctggggtag

DBGET integrated database retrieval system