KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06900Help
Entry
OCA5_c06900       CDS       T01617                                 

Gene name
fadA1
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA5_c06900 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_c06900 (fadA1)
   00640 Propanoate metabolism
    OCA5_c06900 (fadA1)
   00650 Butanoate metabolism
    OCA5_c06900 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    OCA5_c06900 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    OCA5_c06900 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCA5_c06900 (fadA1)
   00310 Lysine degradation
    OCA5_c06900 (fadA1)
   00380 Tryptophan metabolism
    OCA5_c06900 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCA5_c06900 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCA5_c06900 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCA5_c06900 (fadA1)
Enzymes [BR:ocg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCA5_c06900 (fadA1)
Exosome [BR:ocg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA5_c06900 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
725123..726310
Genome map
AA seq 395 aa AA seqDB search
MSDAVIVSTARTPIGKAYRGALNATEGATLFAHAIKAAVERAQLDPAEVEDVVMGAALQQ
GATFANIARKALLRAGLPVTVAGTTVDRQCASGLQAIANAARSVLFDGVGIAVAGGGESI
SLVQNDKMNMFHAVDPALQEIKPDIYMSMLDTAEVVAKRYGISRERQDEYALESQRRIAA
AQQAGRFKDEIAPISTTMGVLDKASGEVSFKDVTLSQDEGPRPDTTAEGLAALKPVKGEG
FTITAGNASQLSDGASAVVVMSDKTAAQRNLKPLGIFRGMVSVGCEPDEMGIGPVFAVPR
LLKRHGLSVDDIDLWELNEAFAVQVVYCRDKFGLDPEKLNVNGGAIGVGHPYGMTGARLA
GHVLIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgccgtcatcgtttccacagcccgcacgccgatcggcaaggcctatcgtggt
gcactgaatgccactgaaggcgcgacgctgttcgcacatgcgatcaaagccgcggtggag
cgggcgcagctcgaccctgccgaggtggaggacgtggtgatgggtgccgcgctgcagcaa
ggggcgacctttgccaacatcgcacgcaaggcactgctgcgtgcgggtctgcccgtcacg
gtcgccggcaccacggtggaccgtcagtgtgcatcgggtctacaggcgattgcgaatgcg
gcgcgctcggtgctgttcgatggcgtcgggatcgcggtggcgggcggcggcgaatcgatc
agcctcgttcagaacgacaagatgaacatgtttcatgcggtcgatccggcgctgcaggag
atcaagcccgatatttacatgtcgatgctcgacaccgccgaggtggtggcgaagcgctac
ggcatttcgcgcgagcggcaggatgagtacgcgctggaaagccagcgccgcatcgccgcc
gcgcagcaggcgggccggttcaaggatgagatcgcgccaatttcaacgacaatgggcgtg
ctcgacaaggcaagcggcgaggtgtcgttcaaggacgtgacgctttcgcaggatgaaggc
ccgcgacccgatacaacggcggagggcctggccgcgctgaagccggtgaagggcgaaggc
ttcaccatcaccgccggcaatgcgagtcagctctccgatggcgcgagcgccgtggtggtg
atgagcgacaagacggccgcgcagcgcaacctgaagccgctcggtatcttccgtggcatg
gtgtcggtcggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgg
cttctcaagcgtcacggcctgagcgtggatgatatcgatctgtgggaattgaacgaggca
ttcgcggtgcaggtcgtctattgccgcgacaagttcgggctcgatcccgagaagctcaac
gtcaacggcggcgccatcggcgtcggccacccctatggcatgaccggcgcgcggcttgcg
ggccatgtgctgatcgaagggcggcggcgcaaggcgaaatacgcagtggtgacgatgtgc
gtcggcggcggcatgggctcggccggtctgttcgagatcgtgcagtag

DBGET integrated database retrieval system