KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06910Help
Entry
OCA5_c06910       CDS       T01617                                 

Gene name
glpK
Definition
glycerol kinase GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ocg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726423..727919
Genome map
AA seq 498 aa AA seqDB search
MTYLLAIDQGTTSSRAMLFREDLSVAAQAQQEVPQHFPASGWVEHDPEDIWATTLATCRA
AMEKGGVTAREIAAIGISNQRETTVVWERASGKAIHRAIVWQDRRTADVCARLQADGHEP
LIATRTGLIADPYFSGTKIAWILDAVPGARARAERGELLFGTVDCYLLWRLTGGAVHATD
ATNASRTLLFDIYAGAWDDDLLRLLRVPRAMLPRVRDCAAEFGTTLPDLLGGPIAVRGIA
GDQQAATVGQACFAPGMMKSTYGTGCFALLNTGATAVASKNKLLTTIAYQLNGVRTYALE
GSIFVAGSAVQWLRDGLHLIKTAHDSDDLAPLADATQAVYLVPAFVGLGAPYWNPRVRGA
LFGLTRNTGPAEFAQAALESVCYQTHDLWTAMRADWPDGVTQNAALRVDGGMAVSDWTMQ
RLADILNVTVDRPVIPETTALGAAYLAGLASGICPPPAEFAARWQLDRRFTPEMDEETRA
RKLTGWTRAVKGLLASED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctcctcgcgatcgatcaaggcaccacgtcctcgcgtgcgatgctgtttcgt
gaggacctgtcggttgcggcgcaggcgcagcaggaagtgccgcagcattttccggcctcg
ggctgggtcgagcacgatccggaggatatctgggcgacgacgctcgcgacctgtcgcgcg
gcgatggagaagggtggcgtcaccgcgcgcgagattgccgccatcggcatcagcaaccag
cgcgagaccacggtggtgtgggagcgcgcgagcgggaaggcgatccatcgcgccatcgtc
tggcaggatcgccgcaccgcggatgtctgcgcgcgattgcaggctgacggccacgagccg
ctgattgccacgcgcacgggactgatcgccgatccgtatttttcgggcaccaagatcgcg
tggattctcgatgccgtccccggcgcgcgtgcgcgggcggagcgtggcgaactgctgttc
ggcaccgtcgattgctatctgttgtggcggctcaccggcggtgcggtgcatgcgaccgac
gccaccaatgcctcgcgcacgctgttgttcgacatttacgccggcgcatgggacgacgac
ctgctgcggctgttgcgggtgccgcgcgcgatgctgccgcgggtgcgcgattgcgcggcg
gagttcggcaccacgctgcccgatctgctcggcggaccaattgccgttcgcggcatcgcg
ggcgatcagcaggcggcgacggtcgggcaggcgtgcttcgcacccggcatgatgaaatcg
acttacggcaccggttgcttcgcgctgctcaacaccggcgccacagccgtcgcgtcaaag
aacaagctgctcacgacgattgcctatcagttgaatggcgtgcgcacctatgcgctcgaa
ggctcgatcttcgttgccggctcggcggtgcaatggctgcgtgatgggctgcatctcatc
aagaccgcgcatgacagtgacgatctcgcgcccttggctgatgcgacgcaggcggtctat
ctcgtgcccgctttcgtcggcctcggtgcgccgtactggaatccgcgcgtgcgcggcgcg
ctgttcggcctcacgcgcaacaccggcccggcggagttcgcgcaagccgcgctcgagagt
gtctgttatcagacgcatgatctgtggaccgcgatgcgcgccgattggccggatggggtg
acgcagaacgcggcgctgcgtgtcgatggcggcatggcggtgtcggattggaccatgcag
cggctcgccgacattctcaacgtcacggtggatcggccggtgatcccggagacgacagcg
ctcggtgcggcctatcttgcgggtcttgcctccggcatttgtccgccgcccgcggagttc
gccgcgcgctggcagctcgaccgccgcttcacgccggagatggatgaggaaacgcgcgcg
cgaaagcttacaggctggacgcgtgcggtgaaaggtctgctcgcgagcgaagattag

DBGET integrated database retrieval system