KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06910Help
Entry
OCA5_c06910       CDS       T01617                                 

Gene name
glpK
Definition
glycerol kinase GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OCA5_c06910 (glpK)
Enzymes [BR:ocg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OCA5_c06910 (glpK)
Exosome [BR:ocg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCA5_c06910 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726423..727919
Genome map
AA seq 498 aa AA seqDB search
MTYLLAIDQGTTSSRAMLFREDLSVAAQAQQEVPQHFPASGWVEHDPEDIWATTLATCRA
AMEKGGVTAREIAAIGISNQRETTVVWERASGKAIHRAIVWQDRRTADVCARLQADGHEP
LIATRTGLIADPYFSGTKIAWILDAVPGARARAERGELLFGTVDCYLLWRLTGGAVHATD
ATNASRTLLFDIYAGAWDDDLLRLLRVPRAMLPRVRDCAAEFGTTLPDLLGGPIAVRGIA
GDQQAATVGQACFAPGMMKSTYGTGCFALLNTGATAVASKNKLLTTIAYQLNGVRTYALE
GSIFVAGSAVQWLRDGLHLIKTAHDSDDLAPLADATQAVYLVPAFVGLGAPYWNPRVRGA
LFGLTRNTGPAEFAQAALESVCYQTHDLWTAMRADWPDGVTQNAALRVDGGMAVSDWTMQ
RLADILNVTVDRPVIPETTALGAAYLAGLASGICPPPAEFAARWQLDRRFTPEMDEETRA
RKLTGWTRAVKGLLASED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctcctcgcgatcgatcaaggcaccacgtcctcgcgtgcgatgctgtttcgt
gaggacctgtcggttgcggcgcaggcgcagcaggaagtgccgcagcattttccggcctcg
ggctgggtcgagcacgatccggaggatatctgggcgacgacgctcgcgacctgtcgcgcg
gcgatggagaagggtggcgtcaccgcgcgcgagattgccgccatcggcatcagcaaccag
cgcgagaccacggtggtgtgggagcgcgcgagcgggaaggcgatccatcgcgccatcgtc
tggcaggatcgccgcaccgcggatgtctgcgcgcgattgcaggctgacggccacgagccg
ctgattgccacgcgcacgggactgatcgccgatccgtatttttcgggcaccaagatcgcg
tggattctcgatgccgtccccggcgcgcgtgcgcgggcggagcgtggcgaactgctgttc
ggcaccgtcgattgctatctgttgtggcggctcaccggcggtgcggtgcatgcgaccgac
gccaccaatgcctcgcgcacgctgttgttcgacatttacgccggcgcatgggacgacgac
ctgctgcggctgttgcgggtgccgcgcgcgatgctgccgcgggtgcgcgattgcgcggcg
gagttcggcaccacgctgcccgatctgctcggcggaccaattgccgttcgcggcatcgcg
ggcgatcagcaggcggcgacggtcgggcaggcgtgcttcgcacccggcatgatgaaatcg
acttacggcaccggttgcttcgcgctgctcaacaccggcgccacagccgtcgcgtcaaag
aacaagctgctcacgacgattgcctatcagttgaatggcgtgcgcacctatgcgctcgaa
ggctcgatcttcgttgccggctcggcggtgcaatggctgcgtgatgggctgcatctcatc
aagaccgcgcatgacagtgacgatctcgcgcccttggctgatgcgacgcaggcggtctat
ctcgtgcccgctttcgtcggcctcggtgcgccgtactggaatccgcgcgtgcgcggcgcg
ctgttcggcctcacgcgcaacaccggcccggcggagttcgcgcaagccgcgctcgagagt
gtctgttatcagacgcatgatctgtggaccgcgatgcgcgccgattggccggatggggtg
acgcagaacgcggcgctgcgtgtcgatggcggcatggcggtgtcggattggaccatgcag
cggctcgccgacattctcaacgtcacggtggatcggccggtgatcccggagacgacagcg
ctcggtgcggcctatcttgcgggtcttgcctccggcatttgtccgccgcccgcggagttc
gccgcgcgctggcagctcgaccgccgcttcacgccggagatggatgaggaaacgcgcgcg
cgaaagcttacaggctggacgcgtgcggtgaaaggtctgctcgcgagcgaagattag

DBGET integrated database retrieval system