KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c06980Help
Entry
OCA5_c06980       CDS       T01617                                 

Gene name
cycM
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
ocg01100  Metabolic pathways
ocg01120  Microbial metabolism in diverse environments
ocg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCA5_c06980 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEI05421
UniProt: B6JJE3
Position
737181..737693
Genome map
AA seq 170 aa AA seqDB search
MDSFELNKIMGAILGTCLVLLVTNFAAQAIFAPQKPEKPGFEIAVKEDASGGAEATKAAE
VPIEQLLANASVEKGQAASKKCAACHTFDKGGPNKVGPNLFGVIDEPKGEGRGFNFSAAM
KAKGGSWTIEDLNQFIKSPKGFVPGTAMGFAGISKDSERADLIAYMKTLK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggactctttcgaactcaacaagatcatgggtgcgattctcggcacttgccttgttctg
ctggtcacgaactttgccgcacaggcgatcttcgcaccgcagaagccggaaaagccgggc
tttgaaattgccgtgaaggaagatgcaagcggtggcgccgaggcgaccaaggcggctgag
gtgccgatcgagcagctgctcgcgaacgcgtcggtcgagaagggccaggcggcttccaag
aagtgcgcagcctgccacaccttcgacaagggcggcccgaacaaggtcggcccgaacctc
tttggcgtcatcgatgagccgaagggcgagggccgcggcttcaacttctccgctgccatg
aaggcgaagggcggaagctggaccatcgaggacctcaaccagttcatcaagagcccgaag
ggtttcgtcccgggcaccgcgatgggttttgccggcatcagcaaggacagcgagcgcgcc
gacctgattgcctatatgaagaccctgaagtaa

DBGET integrated database retrieval system