KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c07290Help
Entry
OCA5_c07290       CDS       T01617                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCA5_c07290 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCA5_c07290 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    OCA5_c07290 (glcB)
Enzymes [BR:ocg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     OCA5_c07290 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(771509..773671)
Genome map
AA seq 720 aa AA seqDB search
MTRTDIAGLKIAPVLADFIDKEAVPGTGISAETFWKGVATLVKEFAPDNRALLQKRDDLQ
AKIDEWHRARRGKPFDLAAYTAFLKEIGYVVPEAPTRLVTTSNVDDEIARIHGPQLVVPL
SNARYSLNAANARWGSLYDALYGTDAIPYDPNYKKNGYDKSRGAKVIAKAKEFLDKSIPL
ANGSHADVTGYAIENGELVAKLADGTSKLKDPAQFIGHKGSLEAPSAILFVNHRLHIEIA
IDRTGAIGKDDPAGVNDIIIESAVTTILDMEDSVAAVDAEDKVLIYRNTLGLMQGTLEAE
FDKGGKTVHRALNADRAYTGRNGKPLTLPGRSLMLVRNVSIHMYTDAVLDADGHEIPEGI
LDAAITALLALHDLKARRNSRAGSVYIVKPKLHGPEEVALTVRLFGRVEECLSLPANTLK
IGIMDEERRTTVNLKNCIQNAAERVCFINTGFLDRTGDEIHTSIEAGPLVRKTEMKSSIW
IKAYEDSNVDTGLLNGLPGHAQIGKGMWAAPDKMADMLAQKIAHPQAGAATAWVPSPTAA
TLHAMHYHLVDIDARQNELKSRPRAKLADILTIPLANSNWSSDDVKEELDNNCQSILGYV
VRWLDQGIGCSKVPDIHNVGLMEDRATLRISSQLLANWLHHGVIEREQVMEALKRMALIV
DKQNAGDPNYKPMAPGYDGIAFQAACDLIFKGREQPNGYTEHILHARRREIKEAARKLAS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcactgacatcgccggcctgaagatcgctcccgtcctggcagacttcattgac
aaagaagccgtgcccggcaccggaatttccgcagaaacgttctggaagggcgtcgccacg
ctggtgaaggaattcgccccggacaaccgcgccctcttgcagaagcgcgacgacctgcag
gccaagatcgacgagtggcatcgcgcccgccgcggcaagccgttcgacctcgccgcctac
accgccttcctgaaagagatcggctatgtcgtgcccgaggcgccgaccaggcttgtcacg
acctcgaacgtcgacgacgaaatcgcacgcattcatgggccgcagcttgtcgtgccgctc
agcaatgcgcgctattcgctcaacgccgccaatgcgcgctggggcagcctgtacgatgcg
ctctacggcaccgacgccattccctacgacccgaactacaagaagaacggctacgacaag
agccgcggcgccaaggtgatcgccaaggcgaaggagtttctcgacaagtcgatcccgctc
gcgaacggcagccacgccgacgtcacgggttacgccatcgagaacggcgaactggtcgcg
aagctcgcagacggcaccagcaagctgaaggaccccgcgcagttcatcggccacaagggc
agccttgaggcaccctcggcgatcctgttcgtcaaccatcgcctgcacatcgagatcgcg
atcgaccgcaccggcgcgatcggcaaggacgatccggccggcgtcaacgacatcatcatc
gaatccgccgtcaccaccatcctcgacatggaagacagcgtcgccgccgtcgatgccgag
gacaaggtgctgatctatcgcaacacgctcggcctgatgcagggcacgctcgaagccgaa
ttcgacaagggcggcaagaccgtgcatcgcgcgctcaatgccgaccgcgcctataccggc
cgcaacggcaagccgctgacactgcccggccgcagcctgatgttggtgcgcaacgtctcg
atccacatgtacaccgacgccgtgctcgacgccgatggccacgagattccggaaggcatt
ctcgatgccgcgatcaccgcgctgctggcgctgcacgacctcaaggcgcgccgcaacagc
cgcgccggttcggtctacatcgtcaagccgaagctgcacggcccggaggaagtggcgctg
acggtgcgcctgttcggccgcgtcgaggagtgcctgtcgctgccggcgaacacgctcaag
atcggcatcatggacgaggagcgccgcaccacggtcaacctcaagaactgcatccagaac
gccgcggagcgcgtctgcttcatcaacaccggcttcctcgaccgcaccggcgacgagatc
cacacctcgatcgaggcgggcccgctggtgcgcaagaccgagatgaagtcgagcatctgg
atcaaggcctacgaggactccaacgtcgacaccggcctcctcaacggcctgcccggccat
gcccagatcggcaagggtatgtgggccgcgcccgacaagatggcggacatgctggcgcag
aagatcgcgcatccgcaggccggcgccgccaccgcgtgggtgccctcgcccaccgccgcg
acgctgcatgcgatgcactatcacctcgtcgatatcgacgcgcggcagaacgaactgaaa
tcgcgcccgcgcgccaagctcgccgacatcctcaccattccgctcgccaactcgaactgg
tcgtccgacgacgtcaaggaagagctcgacaacaactgccagagcatcctcggttatgtc
gtgcgctggctcgatcagggcatcggctgctcgaaggtgccggacatccacaatgtcggt
ctgatggaagaccgcgccacgctgcgcatctcgagccagttgctcgccaactggctgcac
catggcgtgatcgagcgcgagcaggtgatggaagccttgaagcgcatggcgctcatcgtt
gacaagcagaacgcgggcgatccgaactacaagccgatggcgcccggctatgacggcatc
gccttccaggccgcctgcgacctcatcttcaaggggcgcgagcagccgaacggctacacc
gagcacatccttcacgcccggcggcgcgagatcaaggaagcggcgcgaaagctcgcatcc
tga

DBGET integrated database retrieval system