KEGG   Oligotropha carboxidovorans OM5 (Goettingen): OCA5_c07400Help
Entry
OCA5_c07400       CDS       T01617                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ocg  Oligotropha carboxidovorans OM5 (Goettingen)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    OCA5_c07400 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    OCA5_c07400 (bdhA)
Enzymes [BR:ocg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     OCA5_c07400 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
784154..784942
Genome map
AA seq 262 aa AA seqDB search
MSSLAGKAAVVTGSTSGIGLAYARALARAGANIVLNGMGEPADIEKERSGIEREFGVKAV
HSPADMTRPDEIEQMVRLGEKTLGSVDILINNAGIQFVSPVEEFPLDKWDAIIAINLSSA
FHAIRAAVPGMKARGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNAISPGYVWTPLVERQVPDTMKARNMTKEEVIKDVMLLAQPTKEFVTVEQVAALAVYL
CGDEASQITGANLSIDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagttcattggcaggcaaggccgcggtcgtcaccggatcgaccagcggcatcggattg
gcatatgcgcgggcgctcgcgcgggccggcgcgaatatcgtgctgaacggcatgggcgag
cccgccgatatcgagaaggagcggtcggggatcgagcgcgagttcggcgtcaaggcggtt
cattcgcccgccgatatgaccaggcccgatgagatcgaacagatggttcggctcggcgaa
aagacgctcggttcggtcgatattctcatcaacaatgcgggcatccagttcgtctcgccg
gtcgaggaatttccgctcgacaaatgggacgcgatcatcgccatcaatttgtcatcggcg
tttcatgcaatccgcgccgcggtgccaggcatgaaggcgcgcggttggggccgcatcatc
aacaccgcatcggcgcactcgctggtggcctcgccgttcaagtcggcttacgtcgcggcg
aagcacggcattgccggtctcaccaagacggtcgcgctcgaacttgcgacccacaagatc
acctgcaacgccatcagccccggttatgtctggacgccgcttgtcgagcggcaggtgccc
gacaccatgaaggcgcgcaacatgaccaaggaagaggtcatcaaggacgtgatgctgctg
gcgcagccgaccaaggagttcgtcaccgtcgagcaggtcgcggcgcttgcggtctatctc
tgcggcgacgaggcgagccagatcaccggcgccaatctctcgatcgacggcggctggacc
gcggcttaa

DBGET integrated database retrieval system